RetrogeneDB ID:
retro_mputfur_1625
Organism:
Location:
GL897421.1:23215-23904 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
62.5 %
Coverage:
61.76 %
Frameshifts:
1
Stop codons:
5


Parental gene:
Parental gene symbol:
ADH5
Parental gene aliases:
No gene alias available
Parental gene description:
alcohol dehydrogenase 5 (class III), chi polypeptide [Source:HGNC Symbol;Acc:253]

Genomic region (view in browser)





>retro_mputfur_1625
CCAAAGGCTCATGAAGTTTGAAATAAGATTATTTCCACTGTAGTTTGCCACACTAATTCC
TACATTCCGAGTAGAGCAGATCCTTGGTGGAAACTCCCAGTGATCTTGGGACATAAAGGT
GCTAGAATTGTGGAAACTATTGCTGAAGGAGTTACTAAGTTGAAAGTAAGTTATATTGTC
ATCCCACTTTACATTTCACAATGTAGAGAATGCAGATTTTGTCTCAATCCTAAAACAAAT
AGCTCCAGAAGACAAGCGTCATTGAAAAGAAAGGATTAATGTCAAACAGTACTAGCAGAT
TTACCTGAAAAAGAAATACAATTTTGCATTACATGGGAACAAGCATATTTTCTGAATAAA
GAGTTGTGGCTGATTCCTCTTTTGCTGGAATTGATCCTTTAGCACCTTTAGGTAGTCTGC
CTTCTAGTTGCATCATTTCAACAGGTTATAGTGCTGTTGTGAACATAGTCAAGGTGGAGC
CTGGCTCTATTTATGCTGTCCTTGGCCTAGGAGGAGTTGGACTAGCAATTATTGTGGGCT
AAAAGGTGGTTAGTAGGTCCCAGAGCATTGGTATGGACTTAAATAATGATAAATTCAAAA
TGGTCAAGTAGTTTAGGGTCTCTGAATGTATTAATTGCCAGAACTTTAGGAAAACCATTC
AGGAAATGTGCGTTGAGAAGACTCATGGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PKAHEVRIKIIATAVCHTDAYTLSGADPEGSFPVILGHEGAGIVESVGEGVTKVKAGDTVIPLYIPQCGECKFCLNPKTNL-CQKIRVTQGKGLMPDGTS
PKAHEV..KII.T.VCHT..Y..S.ADP....PVILGH.GA.IVE...EGVTK.K....VIPLYI.QC.EC.FCLNPKTN...QK..V...KGLM...TS
Retrocopy
PKAHEV*NKIISTVVCHTNSYIPSRADPWWKLPVILGHKGARIVETIAEGVTKLKVSYIVIPLYISQCRECRFCLNPKTNS/LQKTSVIEKKGLMSNSTS


Parental protein
RFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAKVEPGSTCAVFGLGGVGLAAIMGCKVAGASRIIGVDINKDK
RFT.K..TILHYMGTS.FSE..VVAD.S.A.IDPLAPL.......C.ISTGY.A.VN..KVEPGS..AV.GLGGVGLA.I.G.KV...S..IG.D.N.DK
Retrocopy
RFT*KRNTILHYMGTSIFSE*RVVADSSFAGIDPLAPLGSL-PSSCIISTGYSAVVNIVKVEPGSIYAVLGLGGVGLAIIVG*KVVSRSQSIGMDLNNDK


Parental protein
FARAKEFGASECINPQDFSKPIQEVLIEMTDG
F...K.F..SECIN.Q.F.K.IQE...E.T.G
Retrocopy
FKMVK*FRVSECINCQNFRKTIQEMCVEKTHG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide