RetrogeneDB ID:
retro_mputfur_1628
Organism:
Location:
GL897426.1:70646-71283 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
76.85 %
Coverage:
100.0 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
Atp5o
Parental gene aliases:
No gene alias available
Parental gene description:
ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit [Source:MGI Symbol;Acc:MGI:106341]

Genomic region (view in browser)





>retro_mputfur_1628
ATGACTGTCCCAGCAGAGTCTGGCTTGTGCCAGCAGGTGCGATGCTTTAGTACAACTGTG
ATCAGGCCATTTTCCAAGCTCATGTGGCCACCTGTTCAGGTATATGATATTGAAGGTCAC
TGTGCCACTGCTCTTTATTCTGCTGCATCCAAACCAAATAAACTGTAATGGTAGAGGAAG
AATTGTTGAGAGTAGCACAACTCTTGAAGGAATCCAAAATGGCTGCTTCCATTATGAATC
CCTATATAAAGCGTTCTGTGAAAGTGAAAAGCCTAAATGACATGAGCACAAAAGATAGGT
TCTCTCCTCTCACATCCAACCTGATCAATGTGCTTGCTGAGAATGGTTGCTTGGACAAAA
CCCTTGGAGTCATTTCTGCCTTTTTGAACATGATGAGCATCCACTTAGGGAAAAGTTCTG
TGCACAGTGACCACCACATCTCCTTTAGAAGCCACTCTTATTTAATTAAAAATGGTCCTG
AAGAGCTTCCTAAGTAAAGGCCAAGTCTTGAAATTGGAAGTTAAGACTAATTTGTCAATC
ACTGGTAGAATGATTATCCCTACTGGAGAGAGATATACTGAAATGTCTGTGAAAAACCAA
GATCCAGAAGCTGAACAGTGCCATGTGGGAGGTTTTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAVPAVSGLSRQVRCFSTTVVRPFSKLVRPPVQVYGIEGRYATALYSAASKQNKL-EQVEKELLRVAQILKEPKMAASIMNPYIKRSVKVKSLNDMSAKE
M.VPA.SGL..QVRCFSTTV.RPFSKL..PPVQVY.IEG..ATALYSAASK.NKL...VE.ELLRVAQ.LKE.KMAASIMNPYIKRSVKVKSLNDMS.K.
Retrocopy
MTVPAESGLCQQVRCFSTTVIRPFSKLMWPPVQVYDIEGHCATALYSAASKPNKL/VMVEEELLRVAQLLKESKMAASIMNPYIKRSVKVKSLNDMSTKD


Parental protein
RFSPLTSNLINLLAENGRLDNTPGVISAFSTMMSVHR-GEVPCTVTTASPLDEATLTELKTVLKSFLSKGQVLKLEVKTDPSIMGGMIVRIGEKYADMSA
RFSPLTSNLIN.LAENG.LD.T.GVISAF..MMS.H..G.V.CTVTT.SPL.EATL..LK.VLKSFLSKGQVLKLEVKT..SI.G.MI...GE.Y..MS.
Retrocopy
RFSPLTSNLINVLAENGCLDKTLGVISAFLNMMSIHL\GKVLCTVTTTSPL-EATLI*LKMVLKSFLSKGQVLKLEVKTNLSITGRMIIPTGERYTEMSV


Parental protein
-KTKIQKLSRAMREVF
.KTKIQKL..AM.EVF
Retrocopy
\KTKIQKLNSAMWEVF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide