RetrogeneDB ID:
retro_mputfur_1629
Organism:
Location:
GL897428.1:30785-31367 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
77.55 %
Coverage:
55.43 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
TWF1
Parental gene aliases:
No gene alias available
Parental gene description:
twinfilin actin-binding protein 1 [Source:HGNC Symbol;Acc:9620]

Genomic region (view in browser)





>retro_mputfur_1629
TCCCATCAGTCCCACCTCCAAGCAAGTGAAGATGTTAAAGATACTTTTGCCAGAGAAGAA
ATGAAAAATATTGAGTTCTAAAAATATCTGTTGAAAAAGAGACACTTGTGATTGCATCAT
GTAGTCTGCCTTCCAGTTCCTGGGGTAAGGATTATGATTCCTTTGTTTTACCCCTCCTGG
AGGACAAACAGCCATGCAACATAGTGTTCAGTTTAAACTCTCAGAATGCCCAAGGATATG
AATGGATATTCACTTCCTGGTCTCCAGAATATTCTCATGATCATCAATATATGTTGTATG
TAGGAACTAGTGCAACTCTGAAAAAGGAGTTTGGAGGGGTCCACATTACAGATGAAGTGT
TTGGAACAGTAAAGGAAGATGCATCATTACACGGATATAAAAAACAGTCTTCTGTCACAA
TCTTCTCCTGCCCCATTGACTGCAGCTGAGGAAGAATCACGACAGATTAAAATTAATGAG
GCACAAACTGACATGGGTGTGGACATGAAGCATCAAACACTACAAGGAGTAACATTTCCT
ATTTCTTGAGAAGCTTTTCAAGCTTTGGAAACATTAAGTAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SHQTGIQASEDVKDIFARA-RNGKYRLLKISIENEKLVIGSCSQPSDSWDKDYDSFVLPLLEDKQPCYILFRLDSQNAQGYEWIFIAWSPDHSHVRQKML
SHQ...QASEDVKD.FAR..RN.KY..LKIS.E.E.LVI.SCS.PS.SW.KDYDSFVLPLLEDKQPC.I.F.L.SQNAQGYEWIF..WSP..SH..Q.ML
Retrocopy
SHQSHLQASEDVKDTFARE/RNEKY*VLKISVEKETLVIASCSLPSSSWGKDYDSFVLPLLEDKQPCNIVFSLNSQNAQGYEWIFTSWSPEYSHDHQYML


Parental protein
YAATRATLKKEFGGGHIKDEVFGTVKEDVSLNGYKKY-LVSQSSPAPLTAAEEELRQIKINEVQTDVGVDTKHQTLQGVAFPISREAFQALEQLSN
Y..T.ATLKKEFGG.HI.DEVFGTVKED.SL.GYKK..L.SQSSPAPLTAAEEE.RQIKINE.QTD.GVD.KHQTLQGV.FPIS.EAFQALE.LSN
Retrocopy
YVGTSATLKKEFGGVHITDEVFGTVKEDASLHGYKKQ\LLSQSSPAPLTAAEEESRQIKINEAQTDMGVDMKHQTLQGVTFPIS*EAFQALETLSN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide