RetrogeneDB ID:
retro_mputfur_1632
Organism:
Location:
GL897460.1:19489-20002 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.22 %
Coverage:
55.21 %
Frameshifts:
3
Stop codons:
4


Parental gene:
Parental gene symbol:
RPLP0
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein, large, P0 [Source:HGNC Symbol;Acc:10371]

Genomic region (view in browser)





>retro_mputfur_1632
GACAGAGTGACCTAGAAATCCAACTACTTCCTTAAGATCATTCAGAATGATCATCCAAAT
GCTTCATTGTGGAGCGGACAACGTGGGTTCCAAGGAGACACAGAAGATCTGCATGTCCCT
CCATGGAAGGGCTGTCGCACTGATGGACAAGGACACCATGATATTCAAGACCATCTGAGG
GCATCTGGAGAACAACTGAGCTCTGGAGGAACTAGTGCCTTGTATCTGGGTGAATGTGGG
CTTTGGGTTCACCAAGGAGGACCTCACTGAGATCAGGAACATGCTTCCGACCAATAAGGT
GCCAGCTGTCGCCTGTGCTGGTGCCCTAATCCCAGTGAAGTCACTGTGGCAGCCCACCAC
ACTGGTCTGGGGCCAGAGTAGAACTTCTTCCAGGCTTTCGACATCACCACTAAAATCTCC
AGGGGCACCACTGAAATCCTGAGTGAGGCACAACTGATTAAGACTGGAGACAGATTGGGA
GCCAGTGAAGCCGCACAGCTGAGCATGCTGAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DRATWKSNYFLKIIQLLDDYP-KCFIV-GADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDML
DR.T.KSNYFLKIIQ...D.P.KCFIV.GADNVGSK..Q.I.MSL.G.AV.LM.K.TM..K.I.GHLENN.ALE.L.P.I..NVGF.FTKEDLTEIR.ML
Retrocopy
DRVT*KSNYFLKIIQ--NDHP/KCFIV/GADNVGSKETQKICMSLHGRAVALMDKDTMIFKTI*GHLENN*ALEELVPCIWVNVGFGFTKEDLTEIRNML


Parental protein
LANKVPAAARAGAIA-PCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLN
..NKVPA.A.AGA...P.EVTV.A..TGLGPE...FFQA..ITTKISRGT.EILS..QLIKTGD..GASEA..L.MLN
Retrocopy
PTNKVPAVACAGALI/PSEVTVAAHHTGLGPE-*NFFQAFDITTKISRGTTEILSEAQLIKTGDRLGASEAAQLSMLN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide