RetrogeneDB ID:
retro_mputfur_1633
Organism:
Location:
GL897467.1:119174-119594 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
58.45 %
Coverage:
66.67 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
HMGB2
Parental gene aliases:
No gene alias available
Parental gene description:
high mobility group box 2 [Source:HGNC Symbol;Acc:5000]

Genomic region (view in browser)





>retro_mputfur_1633
TCAGTCAAATTCTCAGAGTTTTATAAGAAGTGCTTAGTGAGGCGGAGAATCATGTCTGCT
AAAGAGAAAGGAAAATTTGAAGACATGGCAAAGGCAAGCAAGGCCCATTATGAAAGAAAA
ATTAAAACTTACATCTCCCCTAAAGGAGAAGCAAAAAAGAATTTCGAGGATCCCAAATGC
ACCCAAGAAGTCTCCTTCAGCCTTTTTCTTGTTTTGTTCCGAGTATCACCCAAAAATCAA
AAGAGAACAACCCAACCAATTCATTGGTGATGTTGCAAAGAAACTGGGAGAGATGTGGAA
TAACACTGCTGCAGATGAGGAGCAGCCTTTAGAAAGGAGGCTGCTAAGCTGGAGGGAGAA
GTACAGAAAAGGTATTGCTGCAGAGCAAGCTAAAGGATGTCTGATGTAGCAAAAAAGGGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDP-NAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMW
SV.F.EF.KKC..R...MSAKEK.KFEDMAK..KA.Y.R..K.Y..PKG..K....DP.NAPK..PSAFFLFCSE..PKIK.E.P...IGD.AKKLGEMW
Retrocopy
SVKFSEFYKKCLVRRRIMSAKEKGKFEDMAKASKAHYERKIKTYISPKGEAKKNFEDP\NAPKKSPSAFFLFCSEYHPKIKREQPNQFIGDVAKKLGEMW


Parental protein
SEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKG-KSEAGKKG
....A...QP.E.......EKY.K.IAA..AKG..S...KKG
Retrocopy
NNTAADEEQPLERRLLSWREKYRKGIAAEQAKG/MSDVAKKG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide