RetrogeneDB ID:
retro_mputfur_1637
Organism:
Location:
GL897502.1:58159-58475 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
83.33 %
Coverage:
71.33 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
UBE2D2
Parental gene aliases:
No gene alias available
Parental gene description:
ubiquitin-conjugating enzyme E2D 2 [Source:HGNC Symbol;Acc:12475]

Genomic region (view in browser)





>retro_mputfur_1637
AATGACAGTCCCTATCAGGGTGGAGTATTTTTCTTGACAATTCATTTCCCAAAAGATTAT
CCCTTCAAGCCACCTGAGATGGCATTTACAAAAAGAATTTATCATCCAAATATTAACAGT
AATGGCAGCATTGGTCTTGATATTCTCTGGTCACAGTGGTCTCCAGCACTAACTATTTCA
AAAGTACTCTTGTCCATCTGTTCTCTGTTGTGTGATCCCAATCCAGATGACCCTTTTAGT
GCCTGAGAATCCTCCTCTACAAAACAGAGAAAAGGACAACAGAATAGCTCAGGAATGGAC
TCAGAAGTATGCGATA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDP-LVPEIARIYKTDREKYNRIAR
NDSPYQGGVFFLTIHFP.DYPFKPP..AFT.RIYHPNINSNGSI.LDIL.SQWSPALTISKVLLSICSLLCDPNPDDP.LVPE........REK.NRIA.
Retrocopy
NDSPYQGGVFFLTIHFPKDYPFKPPEMAFTKRIYHPNINSNGSIGLDILWSQWSPALTISKVLLSICSLLCDPNPDDP\LVPENPPL--QNREKDNRIAQ


Parental protein
EWTQKYAM
EWTQKYA.
Retrocopy
EWTQKYAI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide