RetrogeneDB ID:
retro_mputfur_1638
Organism:
Location:
GL897504.1:67752-68112 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
75.81 %
Coverage:
55.71 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
HPRT1
Parental gene aliases:
No gene alias available
Parental gene description:
hypoxanthine phosphoribosyltransferase 1 [Source:HGNC Symbol;Acc:5157]

Genomic region (view in browser)





>retro_mputfur_1638
AGTGGTGACCCCAGCATCATGATGAGTGATGATAAACCAGGTGATCACCTAGACTTATTC
TGTATACTTCAATCATTATGCTGAGGATTTGGAAAAGGTGTTTATTCATCATGGAATTAT
GGACAGGACCGAGCAGCTTACTCAAGATGTGATGAAGACATGGGAGGTCGTCACATTGTA
GCCCTCTGTGTGCTCGAGGGAGGCTATAAATTCTTTGCTGACCTGCTGGATTGTATCAAA
GCACTGAACAGAAATTGTGATGGATCCATTCCCATTACTGTAGATTTCATCAGACTGAAG
AACTACTATAATGACCAGTCAACAGGGAACATCAAAGTAAATGATGGAGATGATCTCTCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SKSPGVYISDDEPGYDLDLFCIP-HHYAEDLEKVFIPHGLIMDSRTERLARDVMK-EMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDGSIPMTVDF
S..P....SDD.PG..LDLFCI...HYAEDLEKVFI.HG.IMD.RTE.L..DVMK..MGG.HIVALCVL.GGYKFFADLLD.IKALNRN.DGSIP.TVDF
Retrocopy
SGDPSIMMSDDKPGDHLDLFCIL\NHYAEDLEKVFIHHG-IMD-RTEQLTQDVMK/DMGGRHIVALCVLEGGYKFFADLLDCIKALNRNCDGSIPITVDF


Parental protein
IRLKSYCNDQSTGDIKVIGGDDLS
IRLK.Y.NDQSTG.IKV..GDDLS
Retrocopy
IRLKNYYNDQSTGNIKVNDGDDLS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide