RetrogeneDB ID:
retro_mputfur_1641
Organism:
Location:
GL897596.1:14232-14966 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
78.0 %
Coverage:
97.63 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
TSPAN3
Parental gene aliases:
No gene alias available
Parental gene description:
tetraspanin 3 [Source:HGNC Symbol;Acc:17752]

Genomic region (view in browser)





>retro_mputfur_1641
GGCCAATGCAGCATCACTCCTCCAAGACTCTGCTGGTGTTTCCCAACCTTATCTTCTGGG
GGGCAGGTGGCATTTTATGCTATGTGGGAGCCTATATCTTTATCACTTATTATGACTGTG
ACCATTTCTTTGAAAATGTGTATACTCTCTTGTCCGTGGTAGTGATCATAGCTTTAAGAG
CCCTGCTCTTCATTATGGACCTAACTGGCTGCTGTGCCACAATCCGAGAAAGCCACTGTG
GACTTGCCATGTTTGTCATCATCCTATGCTTGCTTTTTGTCAGATAAGTTGCTGTGGTGG
TTTTGGGATATGCTTACAGAGCAAAGGTGGAAAGTGAGGTTGATCGCAGCATTCAGAAAG
TGTGTAAGACCTACAATGAACCGAACCTGATGCTGCTAGCCAGGCTCTTGATTATGTACA
GAGACAGCTTCACTGTTGTGGAATTCACATCTAGTCAGGCTGGGAAAACACAGACTGGTT
CAAAGAGACCAAAAACCAGAGTGTCCTTCGTAGCTGCAGCGGAGAGGCTCAGCAGCTGTA
ATGACAGTCTGGCCCACCCCTCTGACCTCTGTGCTAAGGGATGTGGGGCTCTAGTTGTGA
AGAGGTTACTAGAAGTCATGATGCCTATTATCTGGGCAGCCCTGGCATTTGCAGCTATTC
AGCTGCTGGGCATGTTGTGTGCCTGCATCATATTGTGCAGGAGTAGAGATCCTGCTTGTG
AGCTTCTCCTCACC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GQCGIT-SSKTVLVFLNLIFWGAAGILCYVGAYVFITYDDYDHFFEDVYTLIPAVVIIAVGALLFIIGLIGCCATIRESRCGLATFVIILLLVFVTEVVV
GQC.IT.SSKT.LVF.NLIFWGA.GILCYVGAY.FITY.D.DHFFE.VYTL...VVIIA..ALLFI..L.GCCATIRES.CGLA.FVIIL.L.FV..V.V
Retrocopy
GQCSIT/SSKTLLVFPNLIFWGAGGILCYVGAYIFITYYDCDHFFENVYTLLSVVVIIALRALLFIMDLTGCCATIRESHCGLAMFVIILCLLFVR*VAV


Parental protein
VVLGYVYRAKVENEVDRSIQKVYKTYNGTN-PDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCR-ETASSCNGSLAHPSDLYAEGCE
VVLGY.YRAKVE.EVDRSIQKV.KTYN..N.PDAAS.A.DYVQRQLHCCGIH..S.WENTDWFKETKNQSV.L..C..E..SSCN.SLAHPSDL.A.GC.
Retrocopy
VVLGYAYRAKVESEVDRSIQKVCKTYNEPN/PDAASQALDYVQRQLHCCGIHI*SGWENTDWFKETKNQSV-LRSCS\ERLSSCNDSLAHPSDLCAKGCG


Parental protein
ALVVKKLQEIMMHVIWAALAFAAIQLLGMLCACIVLCRRSRDPAYELLIT
ALVVK.L.E.MM..IWAALAFAAIQLLGMLCACI.LC.RSRDPA.ELL.T
Retrocopy
ALVVKRLLEVMMPIIWAALAFAAIQLLGMLCACIILC-RSRDPACELLLT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide