RetrogeneDB ID:
retro_mputfur_1643
Organism:
Location:
GL897658.1:19869-20540 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.34 %
Coverage:
57.4 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_1643
TTAAAAATTGTCATCATTGGACACATAGATTCAGGCAAATCTATCACTGCTAGTCATCTG
ATCTACAAATGTAGTAGGATCAACATAAGAATTGTTGAAAATTTTTAGAAAGAGGCTGCT
GAGATGGGAAAGGTTTCCTTTAAGTATGCCTGGGTCTTGGATAAACTGAAAGCTGAACAT
GAACGTGATGTCAGCATTGTTATCACCCTGTGGAAATTTGAGACCAACAAGTATGTGACC
ATCATTGATGAACCAAGACACAAAGATTTCATCAAAAACATGAATACAGGCACATCTCAG
GTGGACTGTTCTGTGCTGATTGTTACTGCTGGTGTTGGTATATTTGAAGCAGGTATCTTC
AAGAATGGGCAGAGCCTTAAGCATGTCTCTCTGGCTTACATATTGGGTGTGAAACAACTA
ATTGTTGGCGCTAACAAAATAGACTCCCCTGACTCACCCTATAGCCTGAAGAGACATGAG
AAACTGTTAAGGAAATTAGCACCTACTTTAAGAAAATTGGCTACAACCCTGACACTATAG
CATTTGGGTCAATTTCTGGTTGGAATGGCAACAATATACTGGAGTCAAGTGCAAACATAC
CTTGGTTCAAGGGATGGAAAGTTACCAATAAAGATGGCAATGCCAGTGGAACCACACTGC
TTGAAGCTCTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTS
..IV.IGH.DSGKS.T..HLIYKC..I..R..E.F.KEAAEMGK.SFKYAWVLDKLKAE.ER...I.I.LWKFET.KY.VTIID.P.H.DFIKNM.TGTS
Retrocopy
LKIVIIGHIDSGKSITASHLIYKCSRINIRIVENF*KEAAEMGKVSFKYAWVLDKLKAEHERDVSIVITLWKFETNKY-VTIIDEPRHKDFIKNMNTGTS


Parental protein
QADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYE-EIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSA
Q.DC.VLIV.AGVG.FEAGI.KNGQ...H..LAY.LGVKQLIVG.NK.DS...PYS.KR.E.E.VKE.STY.KKIGYNPDT.AF..ISGWNG.N.LE.SA
Retrocopy
QVDCSVLIVTAGVGIFEAGIFKNGQSLKHVSLAYILGVKQLIVGANKIDSPDSPYSLKRHE/ETVKEISTYFKKIGYNPDTIAFGSISGWNGNNILESSA


Parental protein
NMPWFKGWKVTRKDGNASGTTLLEAL
N.PWFKGWKVT.KDGNASGTTLLEAL
Retrocopy
NIPWFKGWKVTNKDGNASGTTLLEAL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide