RetrogeneDB ID:
retro_mputfur_1644
Organism:
Location:
GL897670.1:20696-21222 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
52.78 %
Coverage:
82.86 %
Frameshifts:
4
Stop codons:
3


Parental gene:
Parental gene symbol:
HMGB2
Parental gene aliases:
No gene alias available
Parental gene description:
high mobility group box 2 [Source:HGNC Symbol;Acc:5000]

Genomic region (view in browser)





>retro_mputfur_1644
ATGTATAGAGGATATCCTAAGAAGAAGCCAAGAGGAAAATATCATCATATGCATTCTTTA
TGAAAACTTGCCTATAAGACCACAAGAAGAAGCAAGTAGATGCTTCAGTCAGTCAAATAT
TCAGTTTTATAAGAAGAGCTTAGCGAATTGGAGGATCATGTCTGCTAAATAGAAAGGAAA
ATTTGAAGACACGGCAAAGGCAAGAAAGGCTCATTATGAAAGAAAAATTAGAACTTATAT
CTCCCCTAAAGGAGAAGCAAAAAGGATGTTTGAGGGTCCCAAATGCACCCAAGAAGACTC
CTTCAGCCTTTTTCTTGTTTTGTTCTGAGTATCACCCAAAAACCAAAAGAGAACTTCCCA
ACCTATTCATTAGTGATGTTGCAAAGAAACTGGGAGAGACGTGGAATAACACTGCTGCAG
ATAATGAGCAGCTTTTTGGAAAGAGGCTGCTAAGCTGAAGGGAGAAGTACAGGAAAGATA
TTGCTGCAGAGCAAGCTAAAGGAAGTCTGATGCATCAAAAAAGGGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGKGDPNK-PRGK-MSSYAFFVQTCREEH-KKKHPDS-SVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGD-KKGKKKDPNAP
M..G.P.K.PRGK..SSYAFF..TC...H.KK....S.S.....F.KK....W..MSAK.K.KFED.AK..KA.Y.R....Y..PKG...KG....PNAP
Retrocopy
MYRGYPKKKPRGK/ISSYAFFMKTCL*DHKKKQVDAS/SQSNIQFYKKSLANWRIMSAK*KGKFEDTAKARKAHYERKIRTYISPKGE\QKGCLRVPNAP


Parental protein
KRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKG-KSEAGKKG
K..PSAFFLFCSE..PK.K.E.P.L.I.D.AKKLGE.W....A...Q..........EKY.KDIAA..AKG.KS.A.KKG
Retrocopy
KKTPSAFFLFCSEYHPKTKRELPNLFISDVAKKLGETWNNTAADNEQLFGKRLLS*REKYRKDIAAEQAKG/KSDASKKG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide