RetrogeneDB ID:
retro_mputfur_1646
Organism:
Location:
GL897700.1:4479-6132 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
94.92 %
Coverage:
81.45 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
SLC30A5
Parental gene aliases:
No gene alias available
Parental gene description:
solute carrier family 30 (zinc transporter), member 5 [Source:HGNC Symbol;Acc:19089]

Genomic region (view in browser)





>retro_mputfur_1646
AGGTGTGGCAGATCACAAGCTTCCAGAAAACTCTCTGTAGATGTTGGTGGAGCCAAACGT
CTTCAAGCTTTATCCCATCTTGTTTCTGTGCTTCTCTTGTGCCCATGGGTCATTGTTCTT
TCTGTGACAACTGAGAGTAAAGTCGAGTCTTGGTTTTCTCTCATAATGCCTTTCACAACA
GTTATCTTTTTTGTCATGATCCTGGATTTCTATGTCGATTCCATTTGTTCAGTCAAAATG
GAAGTTTCCAAATATGCCTGCTATGGATCCTTTCCCATTTTTATTAGTGCTCTACTTTTT
GGAAATTTTTGGACACATCCAATAACAGACCAGCTTCGAGCTTTGAACAAAGCAGCACAC
CAGGAAAGCACTGAACATGTCCTGTCTGGAGGAGTGGTAGTGAGCGCTATATTCTTCATT
TTGTCTGCCAACATCTTATCATCTCCTTCCAAGAGAGGGCAGAAAGGCACCCTAGTTGGA
TATTCTCCTGAAGGAACACCTCTCTATAATTTCATGGGTGATGCTTTCCAGCAGAGCTCC
CAATCGATCCCCAGGTTTATTAAGGAATCACTAAAACAAATTCTTGAGGAGAATGACTCT
AGGCAGATCTTTTACTTCTTATGTTTGAATCTGCTTTTTACCTTTGTTGAATTATTCTAT
GGTGTGTTGACCAATAGTCTGGGTCTGATCTCAGATGGATTTCACATGCTCTTTGACTGC
TCTGCTTTGGTCATGGGTCTTTTTGCGGCCTTGATGAGTAGATGGAAAGCAACTCGGATT
TTTTCCTATGGGTATGGCCGAATAGAAATTCTCTCTGGATTTATTAATGGACTTTTTCTA
ATGGTAATAGCCTTTTTTGTGTTTATGGAGTCAGTGGCTAGATTAATTGATCCTCCAGAA
TTAGACACACATATGTTAACACCAGTCTCAGTTGGAGGGCTGATAGTAAACCTTACTGGT
ATCTGTGCCTTTAGCCATGCCCATAACCATAACCATGGAGCTTCTCAGGGAAGCTGTCAT
TCATCTGATCACAGTCATTCCCACCATATGCATGGACACAGTGACCATGGGCATGGTCAC
AGCCACGGATCTGCAGGCAGAGGCATGAATGCTAACATGAGGGGTGTATTTCTTCATGTT
TTGGCAGACACACTTGGCAGTATTGGTGTAATTGTATCCACAGTTCTTAGAGTGAAGTTT
AGATGGTTCATTCCTGATCCCCTGTGTTCTCTTTCTCTCTTTATTGCTATATTAATATTT
CTCAGTGTTGTTCCACTGATTAAAGATGCCTGTCAGGTTCTACTTTTGAGACTGCCACCA
GAATATGAAAAAGAGCTACATCTTGCTTTAGAAAAGATACAGAAAATTGAAGGATTAATA
TCATACCGATACCCTCATTTTTGGCATCATTCAGCCAGTGTTGTGGCAGGAACAGTTCAT
ATACAGGTGACATCAGATGTGCTGGAACAAAGAATTGTACAGCAGGTTACAGGAATACTT
AAAGATGCTGGAGTAAACAATTTAACAATTCAAGTGGAAAAAGAGGCATATTTTCAACAT
ATGTCTGGCCTAAGTACTGGATTTCATGATGTTCTAGCTATGACAAAACAAATGGAGTCC
ATGAAATACTACAAAGATGGTACTTACATCATG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KVGFHTASRKLSVDVGGAKRLQALSHLVSVLLLCPWVIVLSVTTESKVESWFSLIMPFTTVIFFVMILDFYVDSICSVKMEVSKYACYGSFPIFISALLF
..G...ASRKLSVDVGGAKRLQALSHLVSVLLLCPWVIVLSVTTESKVESWFSLIMPFTTVIFFVMILDFYVDSICSVKMEVSKYACYGSFPIFISALLF
Retrocopy
RCGRSQASRKLSVDVGGAKRLQALSHLVSVLLLCPWVIVLSVTTESKVESWFSLIMPFTTVIFFVMILDFYVDSICSVKMEVSKYACYGSFPIFISALLF


Parental protein
GNFWTHPITDQLRALNKAAHQESTEHVLSGGVVVSAIFFILSANILSSPSKRGQKGTLIGYSPEGTPLYNFMGDAFQHSSQSIPRFIKESLKQILEENDS
GNFWTHPITDQLRALNKAAHQESTEHVLSGGVVVSAIFFILSANILSSPSKRGQKGTL.GYSPEGTPLYNFMGDAFQ.SSQSIPRFIKESLKQILEENDS
Retrocopy
GNFWTHPITDQLRALNKAAHQESTEHVLSGGVVVSAIFFILSANILSSPSKRGQKGTLVGYSPEGTPLYNFMGDAFQQSSQSIPRFIKESLKQILEENDS


Parental protein
RQIFYFLCLNLLFTFVELFYGVLTNSLGLISDGFHMLFDCSALVMGLFAALMSRWKATRIFSYGYGRIEILSGFINGLFLMVIAFFVFMESVARQVQIPL
RQIFYFLCLNLLFTFVELFYGVLTNSLGLISDGFHMLFDCSALVMGLFAALMSRWKATRIFSYGYGRIEILSGFINGLFLMVIAFFVFMESVAR....P.
Retrocopy
RQIFYFLCLNLLFTFVELFYGVLTNSLGLISDGFHMLFDCSALVMGLFAALMSRWKATRIFSYGYGRIEILSGFINGLFLMVIAFFVFMESVARLIDPPE


Parental protein
LVKTLLFPVSVGGLIVNLIGICAFSHAHNHNHGASQGSCHSSDHSHSHHMHGHSDHGHGHSHGSAGRGMNANMRGVFLHVLADTLGSIGVIVSTVLIEQF
L....L.PVSVGGLIVNL.GICAFSHAHNHNHGASQGSCHSSDHSHSHHMHGHSDHGHGHSHGSAGRGMNANMRGVFLHVLADTLGSIGVIVSTVL...F
Retrocopy
LDTHMLTPVSVGGLIVNLTGICAFSHAHNHNHGASQGSCHSSDHSHSHHMHGHSDHGHGHSHGSAGRGMNANMRGVFLHVLADTLGSIGVIVSTVLRVKF


Parental protein
GWFIADPLC--SLFIAILIFLSVVPLIKDACQVLLLRLPPEYEKELHLALEKIQKIEGLISYRDPHFWRHSASVVAGTIHIQVTSDVLEQRIVQQVTGIL
.WFI.DPLC..SLFIAILIFLSVVPLIKDACQVLLLRLPPEYEKELHLALEKIQKIEGLISYR.PHFW.HSASVVAGT.HIQVTSDVLEQRIVQQVTGIL
Retrocopy
RWFIPDPLCSLSLFIAILIFLSVVPLIKDACQVLLLRLPPEYEKELHLALEKIQKIEGLISYRYPHFWHHSASVVAGTVHIQVTSDVLEQRIVQQVTGIL


Parental protein
KDAGVNNLTIQVEKEAYFQHMSGLSTGFHDVLAMTKQMESMKYYKDGTYIM
KDAGVNNLTIQVEKEAYFQHMSGLSTGFHDVLAMTKQMESMKYYKDGTYIM
Retrocopy
KDAGVNNLTIQVEKEAYFQHMSGLSTGFHDVLAMTKQMESMKYYKDGTYIM


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide