RetrogeneDB ID:
retro_mputfur_1647
Organism:
Location:
GL897741.1:14195-14891 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
82.63 %
Coverage:
78.45 %
Frameshifts:
3
Stop codons:
5


Parental gene:
Parental gene symbol:
EMC2
Parental gene aliases:
No gene alias available
Parental gene description:
ER membrane protein complex subunit 2 [Source:HGNC Symbol;Acc:28963]

Genomic region (view in browser)





>retro_mputfur_1647
GATGTCACTTGGGAAGAAATGTGAGATAAAATGAGAAAATGGAGAGAAGAAGACTCATGA
AACAGTGAGCAAATTGTGGAAGTTTAGAAGAATTAATTAATGAATATGGATCTAAGCTTG
GAGATGATATTCGGGTCATATATGAGCAAGTGATGATTGCAGCCCTAGACTATAGTTGAG
ATGACTTGGCATTGTTTTGTCTTCAGGAGTTGAGAAGACAGTTCCCTGGCAGTCACGGAG
TCAAGAGACTAACTGGCATAAGATTTGAAGCCATGGAAAGATATGATGATGCTATACAAC
CACATGGTAAAATTTTACAAGAAGATCCAACTAACACTGCTGCAAGAACGCCTGATTGTC
ATTTGAAAAGCCCAGGGGAAAACTGTTGAGGCCATTTGGGAACTGAATGAGTATCTGTAA
CAAATTTCTGGGGGCCAAGAAGCCTGGCTTGAACTTGCAGAACTTTATATCAATGAACAT
GACTATGCTAAGGCAACCTTTTGTTTAGAGGAGCTAATGATGGCTAATCCACACAATCAC
TTACATTGTCAGCAGTATGCTGAAGTTAAATATACCCAAGGTGGACTCGAAAACCTCGAA
CTTTCAAGAAAGTATTTTGCAGAGGCACTGAAACTCAGCAACAGAAATATGAGAGCTTTG
TGTGGGCTTTTCATGTCAGCAAGTCATATTGCTTCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DVTWEEMRDKMRKWREENSRNSEQIVEVG-EELINEYASKLGDDIWIIYEQVMIAALDYGRDDLALFCLQELRRQFPGSHRVKRLTGMRFEAMERYDDAI
DVTWEEM.DKMRKWREE.S.NSEQIVEV..EELINEY.SKLGDDI..IYEQVMIAALDY..DDLALFCLQELRRQFPGSH.VKRLTG.RFEAMERYDDAI
Retrocopy
DVTWEEM*DKMRKWREEDS*NSEQIVEV*/EELINEYGSKLGDDIRVIYEQVMIAALDYS*DDLALFCLQELRRQFPGSHGVKRLTGIRFEAMERYDDAI


Parental protein
QLYDRILQEDPTNTAARKRK-IAIRKAQG-KNVEAIRELNEYLEQFVGDQEAWHELAELYINEHDYAKAAFCLEELMMTNPHNHLYCQQYAEVKYTQGGL
Q....ILQEDPTNTAAR........K..G.K.VEAI.ELNEYL.Q..G.QEAW.ELAELYINEHDYAKA.FCLEELMM.NPHNHL.CQQYAEVKYTQGGL
Retrocopy
QPHGKILQEDPTNTAARTPD/LSFEKPRG/KTVEAIWELNEYL*QISGGQEAWLELAELYINEHDYAKATFCLEELMMANPHNHLHCQQYAEVKYTQGGL


Parental protein
ENLELSRKYFAQALKLNNRNMRALFGLYMSASHIAS
ENLELSRKYFA.ALKL.NRNMRAL.GL.MSASHIAS
Retrocopy
ENLELSRKYFAEALKLSNRNMRALCGLFMSASHIAS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide