RetrogeneDB ID:
retro_mputfur_1648
Organism:
Location:
GL897817.1:8838-9656 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
54.45 %
Coverage:
62.22 %
Frameshifts:
5
Stop codons:
5


Parental gene:
Parental gene symbol:
UBXN6
Parental gene aliases:
No gene alias available
Parental gene description:
UBX domain protein 6 [Source:HGNC Symbol;Acc:14928]

Genomic region (view in browser)





>retro_mputfur_1648
CGGGATAGGGTGAACATGGGTGTGGGCATTATTTCTAAGAACGTGGACAGTGTCTATCTT
CATCTCAAGGAGGAGAGGTACCGAAAGACCAAACTACAGAGCAAGGTGTTCCAGGAGTGT
GTTAACTGCCTGGAAGAGACCCATGAGTTTTTTGAGGCCATTGGTTTCCAAAAGACAGTG
CTTCCCAATTAATAGGGCACCTCAGAGTTCTACTATCTGAGGCAAGTCACCCTGGCCCAG
AGCCAGAACCTGGAGAGGGACAGAGAGCAGGGGCTGGGAGGGGAGCCAGAGGCAACCAAA
CTGAACCTACAGTCCTGGCTATTCAGCCCTTGGCTCCAGACCACCCAGTTCCTTCTGCCC
TGGGGATTCCTTCCACCTCACAACAGACTTGATCTAGCAGGAGCAGAGGTTCAGCTCTGA
AGTAGTGGAGCTGTAGGGTGCTGCTGCCCAAAACCAGGAAGGAGAAGGAAGATGAAAAGA
GATGTGAAAATGTACCTACAAGCTGCTGTGTATCCGCTTCATCGAAGGCTGCCTCCTCTA
GGGCGCCTCCTGTGCCTGGGAGCAGGTGGAGTCAGTACTGTACAGATTCCTCCTTGAGCC
CTGGAGAATGACTGGCAGCCTTTCCAGCTGCTAGCTTCAGGAGGGCAGAAATTGTCGCAG
AATGAGAACCTTGCCATTAATGAGTGTGAACTGGTGCCTTCAGTCCTCCTGACTTTCTCC
TGGGACACAACTGGGCTAGAGGACATGAAGGTCATGGGGCCAAACCACACTCATCTATCT
TGAAGCTCAAGCTTCTGTGGGGCATTAAGAAGCTCTCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RDRVKLGVDTIAKYLDNICLHPEEEKYRKIKLQNRVFQERINCLEGTHEFFEAIGFQKALLPVPDQEGPEEFYVLSEGVLAQPQSLQRHKEQLLVAEPVR
RDRV..GV..I.K..D...LH..EE.YRK.KLQ..VFQE..NCLE.THEFFEAIGFQK..L..P...G..EFY.L....LAQ.Q.L.R..EQ.L..EP..
Retrocopy
RDRVNMGVGIISKNVDSVYLHLKEERYRKTKLQSKVFQECVNCLEETHEFFEAIGFQKTVL--PN**GTSEFYYLRQVTLAQSQNLERDREQGLGGEPEA


Parental protein
ATLARQRRLFRPSPMASQFELP-GDFFNLTAEEIKREQRLRSEAVERL-SVLRTKAMREREEQR-ELRKYTYTLLRVRLPDGCLLQGTFYARERV-AALY
..L..Q..LF.P.....QF.LP.GD.F.LT...I..EQR..S..V..L..VL..K...E.E....E..K.TY.LL..R...GCLL.G...A.E.V...LY
Retrocopy
TKLNLQSWLFSPWLQTTQFLLP\GDSFHLTTDLI*QEQRF-SSEVVEL\RVLLPKTRKEKEDEK/EM*KCTYKLLCIRFIEGCLL*GASCAWEQVESVLY


Parental protein
AFVRE-ALQNDWLPFDLLASGGQRLSEDESLAFNECGLVPSALLTFSWDAAVLEDIKAAGAN-PDSSILKPELLAAIEKLS
.F..E.AL.NDW.PF.LLASGGQ.LS..E.LA.NEC.LVPS.LLTFSWD...LED.K..G.N.P.SSILK..LL..I.KLS
Retrocopy
RFLLE/ALENDWQPFQLLASGGQKLSQNENLAINECELVPSVLLTFSWDTTGLEDMKVMGPN/PHSSILKLKLLWGIKKLS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide