RetrogeneDB ID:
retro_mputfur_1649
Organism:
Location:
GL897942.1:4458-4707 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.52 %
Coverage:
77.78 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
Fkbp1a
Parental gene aliases:
No gene alias available
Parental gene description:
FK506 binding protein 1a [Source:MGI Symbol;Acc:MGI:95541]

Genomic region (view in browser)





>retro_mputfur_1649
ATGGGAGTGCAAGGGAGACCATCTCCCTGGAGTTGGATTCACTTTCCCCGAGTGTGATCA
AACCTACATGGTGCACTATCTGGGGATACTTGAAGATGGAAAGAAACTTGATTATCTCAG
GGACAGAAACAAGCTCTTTAGGTTTATCTTAGGCAGCAAGAGGTTACCTGAGGCTTAGAA
GAAGGGGTTGCCCACAAGAATATGGATCAGAGAGCCAAACTGACTATCTCTCCAGACTAC
ATTTCTGGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGVQV-ETIS-PGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLG-KQEVIRGWEEGVAQMSVGQRAKLTISPDYAYG
MGVQ..ETIS.PG.G.TFP...QT..VHY.G.LEDGKK.D..RDRNK.F.F.LG..QEV..G.EEGVA.....QRAKLTISPDY..G
Retrocopy
MGVQG/ETIS/PGVGFTFPECDQTYMVHYLGILEDGKKLDYLRDRNKLFRFILG/QQEVT*GLEEGVAHKNMDQRAKLTISPDYISG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide