RetrogeneDB ID:
retro_mputfur_1650
Organism:
Location:
GL898387.1:1073-1399 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.27 %
Coverage:
95.61 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
ATP5G2
Parental gene aliases:
No gene alias available
Parental gene description:
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9) [Source:HGNC Symbol;Acc:842]

Genomic region (view in browser)





>retro_mputfur_1650
TTCCTGATCAGGAACACCTCTCAGCAATGGAGACAATCACTGTCTGCCATGGTACTAAAA
CAACCAAAGACACTGTCAGAAGAGAATCTAAGCAGCTTGGCAACCCCATGTCCTCTAACC
TCACTTACTCCTAGTTGCAGCTTTTGAACAAGTGCCGTTTCAAGGGACACTGACATAGCC
GCCAAGTTCATTGGGGTTGGGACTGCCATGGTAGGGGTGGCTGGCTATGGGCTGGAATTT
GGACTGTGTTTGGGAGCCTCATCATTGGTTTTGCTGGGAGCCCTTCTCTGAAGCAATAGG
TCTTCTCCTAAACCATTTGGAACTTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FLVRSTSQLLSRSLSAVVLKPPETLTDEGLSILAAPRPLTSLIPSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSG-AGIGTVFGSLIIGYARNPSLKQ
FL.R.TSQ....SLSA.VLK.P.TL..E.LS.LA.P.PLTSL.PS.SF.TSA.SRD.D.AAKFIG.G.A.VGVAG.G.AGI.TVFGSLIIG.A..PSLKQ
Retrocopy
FLIRNTSQQWRQSLSAMVLKQPKTLSEENLSSLATPCPLTSLTPSCSF*TSAVSRDTDIAAKFIGVGTAMVGVAGYG/AGIWTVFGSLIIGFAGSPSLKQ


Parental protein
QLFSYAILGF
..FS..I..F
Retrocopy
*VFS*TIWNF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide