RetrogeneDB ID:
retro_mputfur_1651
Organism:
Location:
GL898446.1:676-1203 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
75.14 %
Coverage:
69.96 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
TSPAN3
Parental gene aliases:
No gene alias available
Parental gene description:
tetraspanin 3 [Source:HGNC Symbol;Acc:17752]

Genomic region (view in browser)





>retro_mputfur_1651
ATGGGCCAGTGCAGCATCACTCCTCCAAGACTCTGCTGTTGTTTCTCAACCTTATCTTCT
GGGGGGCAGGTGATATTTTATACTATGTGGGAGCCTGTCTTTATCACTTATAATGACTGT
GACCATTTCTTTGAAAATGTGTATGTATACTCTTGCCTGTGGTAGTGATCATAGCTGTAG
GAGCCCTGCTTTTCATTATTGACCTAATTGGCTGCTGTGCCATAATCCGAGAAAGCCACT
GTGGACTTGCCATGTTTGTCATCATCCTATGCTTGCTTTTTGTCACAGAAGTTGTTGTGG
TTTTGGGATGTGCTTACAGAGCAAAGGTGGAAAGTGAGGTTGATCGCAGCATTCAGAAAG
TGTGTAAGACCTACAATGGAACAGAACCTGATGCTTCTAGCCGGACTCTTGATTATGTAC
AGAGACAGCTTCACTGTTGTGGAATTCACATCTAGTCAGGCTGGGAAAACACAGACTGGT
TCAAAGAGACCAAAAACCAGAGTGTCCTTCGTAGCTGCAGCGGAGAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGQCGIT-SSKTVLVFLNLIFWGAAGILCY-VGAYVFITYDDYDHFFEDVYT-LIPAVV-IIAVGALLFIIGLIGCCATIRESRCGLATFVIILLLVFVT
MGQC.IT.SSKT.L.FLNLIFWG.AG...Y.....VFITY.D.DHFFE.VY......VV.IIAVGALLFII.LIGCCA.IRES.CGLA.FVIIL.L.FVT
Retrocopy
MGQCSIT/SSKTLLLFLNLIFWG-AGDILY\MWEPVFITYNDCDHFFENVYV/ILLPVVVIIAVGALLFIIDLIGCCAIIRESHCGLAMFVIILCLLFVT


Parental protein
EVVVVVLGYVYRAKVENEVDRSIQKVYKTYNGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRE
E.VVVVLG..YRAKVE.EVDRSIQKV.KTYNGT.PDA.SR..DYVQRQLHCCGIH..S.WENTDWFKETKNQSV..SC..E
Retrocopy
E-VVVVLGCAYRAKVESEVDRSIQKVCKTYNGTEPDASSRTLDYVQRQLHCCGIHI*SGWENTDWFKETKNQSVLRSCSGE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide