RetrogeneDB ID:
retro_mputfur_1653
Organism:
Location:
GL898642.1:339-728 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.99 %
Coverage:
79.75 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
KRTCAP2
Parental gene aliases:
No gene alias available
Parental gene description:
keratinocyte associated protein 2 [Source:HGNC Symbol;Acc:28942]

Genomic region (view in browser)





>retro_mputfur_1653
GCCGTGGGCACGGGCAGCTCACTGGCACTCTCCCCACTCCTGTCCCTGCTGTTCTTCCTC
GGGATGCACATGTATAAGCTCCAGCTGACCTGCACGCAGCAGCTCACCATCAAGGGGGGC
CTGCTGGGCTCCAGCCTTTTAGTCTTCTCTCTCACGCCACCAGGAATCTTGAGAATGTTG
TCTTTGGCAAAGGATTCCAAGCAAAGATCTTCCCCGAGATTCTTCCCTGTCTCCTGTTGG
CTCTCCTTGCATCTGGCCTCATCCACCAAGTCTGCATTACCCTCTGCCTCACCTTCTCTA
TGGTTGGCCTCTCCCACACCAATAAGATCTCCTCCACTCTGTGCCAGACAACGATTCCAC
TCCTCACAGCAGCCAAGATCCCGGGAAGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLT-AFNNLENLVFGKGFQAKIFPETLLCLLLALLASGLIHRVCVTTCFIF
AVGTG.SLALS.LLSLL.F.GM.MY..QL..T..LTI.GGLLGS.L.VFSLT.A..NLEN.VFGKGFQAKIFPE.L.CLLLALLASGLIH.VC.T.C..F
Retrocopy
AVGTGSSLALSPLLSLLFFLGMHMYKLQLTCTQQLTIKGGLLGSSLLVFSLT/ATRNLENVVFGKGFQAKIFPEILPCLLLALLASGLIHQVCITLCLTF


Parental protein
SMVGLYYINKISSTLYQAAAPVLTPARVTGK
SMVGL...NKISSTL.Q...P.LT.A...G.
Retrocopy
SMVGLSHTNKISSTLCQTTIPLLTAAKIPGR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide