RetrogeneDB ID:
retro_mputfur_169
Organism:
Location:
GL896980.1:6698917-6700771 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
92.33 %
Coverage:
93.73 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
KLHL13
Parental gene aliases:
No gene alias available
Parental gene description:
kelch-like family member 13 [Source:HGNC Symbol;Acc:22931]

Genomic region (view in browser)





>retro_mputfur_169
ATGAAAGTGTCTCTTGGTAACGGTGAAATGGGCGTCTCCGCCCATCTGCAGCCTTGCAAG
GCAGGAACCACACGGTTTTTTACCAGCAATACTCACAGCTCGGTGGTATTGCAAGGCTTC
GATCAGCTTAGAATAGAAGGCTTGCTTTGTGATGTGACCCTGGTACCCGGTGACGGAGAT
GAAATCTTCCCCGTCCACAGAGCTATGATGGCGTCTGCCAGTGATTATTTCAAGGCGATG
TTCACAGGTGGAATGAAAGAACAGGATTTAATGTGCATTAAGCTTCATGGGGTGAACAAG
GTTGGCCTGAAGAAAATAATTGATTTTATTTATACTGCAAAACTTTCCCTTAATATGGAC
AATCTCCAGGACACACTTGAAGCTGCCAGCTTTTTACAAATTTTACCTGTCTTGGACTTC
TGTAAAGTATTTCTTATTTCAGGAGTCTCTTTAGATAACTGTGTTGAAGTTGGACGAATT
GCTAACACCTACAATCTTATCGAAGTGGATAAATATGTCAATAATTTCATCCTGAAGAAT
TTTCCTGCTTTACTGAGTACTGGGGAGTTTCTGAAGCTCCCCTTTGAACGGCTTGCCTTT
GTGCTTTCTAGTAATAGTCTTAAGCACTGTTCTGAACTTGAGCTCTTCAAGGCTGCCTGT
CGCTGGCTAAGATTGGAAGACCCTCGGATGGATTATGCTGCAAAATTAATGAAGAACATT
CGATTTCCATTGATGACACCCCAGGATCTCATCAATTACGTGCAGACAGTAGATTTCATG
AGAACAGACAATACCTGTGTGAATTTGCTTTTAGAAGCTAGCAATTACCAAATGATGCCG
TATATGCAGCCAGTGATGCAGTCAGATAGAACTGCCATTCGATCTGACTCAACACACCTG
GTCACCTTAGGAGGAGTTTTGAGACAGCAGCTGGTTGTCAGTAAAGAATTGCGGATGTAT
GATGAAAGGGCACAAGAATGGAGATCTCTAGCCCCCATGGATGCTCCTCGATACCAGCAT
GGTATTGCTGTCATTGGAAACTTTCTTTATGTAGTTGGTGGTCAAAGCAATTATGATACG
AAAGGAAAAACTGCTGTTGATACAGTTTTCAGGTTTGATCCTCGGTATAATAGGTGGATG
CAGGTTGCATCACTAAATGAAAAGCGCACATTCTTTCACCTGAGTGCCCTCAAAGGACAT
TTATATGCTGTTGGTGGGCGAAGTGCAGCTGGTGAACTGGCCACAGTAGAATGTTACAAC
CCAAGGATGAATGAGTGGAGCTATGTTGCAAAAATGAGTGAACCCCACTATGGCCATGCT
GGAACAGTGTATGGGGGCCTAATGTATATTTCAGGAGGAATTACTCATGACACCTTCCAG
AATGAGCTCATGTGTTTTGACCCAGATACAGACAAATGGACACAGAAGGCTCCAATGACG
ACAGTCAGAGGTCTGCACTGCATGTGTACAGTTGGAGACAAGCTCTATGTCATTGGTGGC
AATCACTTCAGAGGAACAAGTGATTATGATGATGTTCTAAGCTGTGAATACTATTCGCCA
ACCCTTGACCAGTGGACACCAATTGCTGCTATGTTAAGAGGTCAAAGTGATGTTGGAGTT
GCCGTCTTTGAAAATAAAATCTATGTTGTAGGTGGATATTCCTGGAATAATCGTTGTATG
GTAGAAATTGTCCAGAAATATGACCCAGAAAAGGATGAGTGGCATAAAGTTTTTGACCTT
CCAGAATCACTTGGTGGCATTCGGGCTTGTACTCTCACAGTTTTTCCACCTGAGGAAAAC
CCTGGATCACCTTCTAGAGAATCACCTCTTTCAGCACCTTCGGATCATTCTTAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MKLSLGSSEMGLSSHLQSSKAGTTRIFTSNTHSSVVLQGFDQLRLEGLLCDVTLMPGDTDDAFPVHRVMMASASDYFKAMFTGGMKEQDLMCIKLHGVSK
MK.SLG..EMG.S.HLQ..KAGTTR.FTSNTHSSVVLQGFDQLR.EGLLCDVTL.PGD.D..FPVHR.MMASASDYFKAMFTGGMKEQDLMCIKLHGV.K
Retrocopy
MKVSLGNGEMGVSAHLQPCKAGTTRFFTSNTHSSVVLQGFDQLRIEGLLCDVTLVPGDGDEIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGVNK


Parental protein
VGLRKIIDFIYTAKLSLNMDNLQDTLEAASFLQILPVLDFCKVFLISGVTLDNCVEVGRIANTYNLTEVDKYVNSFVLKNFPALLSTGEFLKLPFEHLAF
VGL.KIIDFIYTAKLSLNMDNLQDTLEAASFLQILPVLDFCKVFLISGV.LDNCVEVGRIANTYNL.EVDKYVN.F.LKNFPALLSTGEFLKLPFE.LAF
Retrocopy
VGLKKIIDFIYTAKLSLNMDNLQDTLEAASFLQILPVLDFCKVFLISGVSLDNCVEVGRIANTYNLIEVDKYVNNFILKNFPALLSTGEFLKLPFERLAF


Parental protein
VLSSNSLKHCTELELFKATCRWLRLEEPRMDFAAKLMKNIRFPLMTPQELINYVQTVDFMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDTTHL
VLSSNSLKHC.ELELFKA.CRWLRLE.PRMD.AAKLMKNIRFPLMTPQ.LINYVQTVDFMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSD.THL
Retrocopy
VLSSNSLKHCSELELFKAACRWLRLEDPRMDYAAKLMKNIRFPLMTPQDLINYVQTVDFMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDSTHL


Parental protein
VTLGGVLRQQLVVSKELRMYDEKAHEWKSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWMQVASLNEKRTFFHLSALKGY
VTLGGVLRQQLVVSKELRMYDE.A.EW.SLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYN.WMQVASLNEKRTFFHLSALKG.
Retrocopy
VTLGGVLRQQLVVSKELRMYDERAQEWRSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNRWMQVASLNEKRTFFHLSALKGH


Parental protein
LYAVGGRNAAGELPTVECYNPRTNEWTYVAKMSEPHYGHAGTVYGGVMYISGGITHDTFQKELMCFDPDTDKWIQKAPMTTVRGLHCMCTVGERLYVIGG
LYAVGGR.AAGEL.TVECYNPR.NEW.YVAKMSEPHYGHAGTVYGG.MYISGGITHDTFQ.ELMCFDPDTDKW.QKAPMTTVRGLHCMCTVG..LYVIGG
Retrocopy
LYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVYGGLMYISGGITHDTFQNELMCFDPDTDKWTQKAPMTTVRGLHCMCTVGDKLYVIGG


Parental protein
NHFRGTSDYDDVLSCEYYSPILDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDPDKDEWHKVFDLPESLGGIRACTLTVFPPEET
NHFRGTSDYDDVLSCEYYSP.LDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDP.KDEWHKVFDLPESLGGIRACTLTVFPPEE.
Retrocopy
NHFRGTSDYDDVLSCEYYSPTLDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTVFPPEEN


Parental protein
TPSPSRDSPLSAP
..SPSR.SPLSAP
Retrocopy
PGSPSRESPLSAP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide