RetrogeneDB ID:
retro_mputfur_190
Organism:
Location:
AEYP01110452.1:4104-4534 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
59.03 %
Coverage:
98.58 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
RPL26L1
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L26-like 1 [Source:HGNC Symbol;Acc:17050]

Genomic region (view in browser)





>retro_mputfur_190
AAGTTGAATCCCTTTGTGACTTCTGACCTGAGCAAGAAGCAGAAACGGCATTTTAGTGCA
CCTTCTCACACTCGCAGGAAGATTATGTCTTCCTGTCTTTCTAAAGAGCTGACACAGAAG
TACAATCCTTCATCCGTGCCCACCTGAAGGGATGATGAGGTACAGGTTGTGCCAGGACAC
GACAAAAGCCAGCCAGCAAATTGGCAAAGTTGTCTACATTTAGAAGAAATAGATCATCTA
CATTGAATGAGTACAGCGTGAGAAGGTGAATGGCATGAATGTCCATGTGGGCATTCACCC
TAGCAAGGTGGCTACCACTAGACTAAAGCTAGACAAAACCCTCAAAATGATCTTTGAAGG
TCAAGCCAGATCTCATCAGGTAGGAAAGGAAAACTGGAAATGTAAGGAAGAAACATTGGC
AAGACAGAGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KFNPFVTLDRSKNRKRHFNAPS-VRRKIMSSPL-KELRQKYNIRSMPIRKDDDVQMVRGHYKGQQIGKVVQVHR-KKYVIYIEQVQHEKANGTTVHVGIH
K.NPFVT.D.SK..KRHF.APS..RRKIMSS.L.KEL.QKYN..S.P...DD.VQ.V.GH.K.Q........H..KK..IYIE.VQ.EK.NG..VHVGIH
Retrocopy
KLNPFVTSDLSKKQKRHFSAPSHTRRKIMSSCLSKELTQKYNPSSVPT*RDDEVQVVPGHDKSQPANWQSCLHL\KK*IIYIE*VQREKVNGMNVHVGIH


Parental protein
PSKVVITRLKLDKDWKKIL--KRKSRQVGKEKGKYKEELLEKMQ
PSKV..TRLKLDK..K.I......S.QVGKE..K.KEE.L....
Retrocopy
PSKVATTRLKLDKTLKMIFEGQARSHQVGKENWKCKEETLARQR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide