RetrogeneDB ID:
retro_mputfur_193
Organism:
Location:
AEYP01110705.1:3872-4746 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.53 %
Coverage:
65.84 %
Frameshifts:
2
Stop codons:
9


Parental gene:
Parental gene symbol:
EIF3E
Parental gene aliases:
No gene alias available
Parental gene description:
eukaryotic translation initiation factor 3, subunit E [Source:HGNC Symbol;Acc:3277]

Genomic region (view in browser)





>retro_mputfur_193
TTACAAGGAAAATTTGATCTTCTTAGTGATACTGACGTGGTGGGCTTTGCTATGAATGTA
TGCAAAAACCTTTATTCTGATAATATTCTACATGCTTTGAAAGAATAAAGAACCACAGCC
GTTGCACAACTGAAACAGCTTCAGGCAGAGATGGAACCAATGGTGAATAGGTTTGATCCA
GAAACTACAAGGCAGATGGGGTCAACTAGCAATGGTCAGAGGCTGTTTGACTAACTGATG
GACAAACATGATTTTAGGCAGTAATATTTAGATACACTCTACAGGCATGCAAAAGTCCAA
TATGAATGTGGGAATTACCCTGGAGCAGCAGTATAGCTTTACTTCTTTAGAGTGTTAGTT
CCAGCAACAGATAGAAATGTTTTGAATTCACTCTGGGAAAAACTGGCCTCCAAATCTTAA
TGTGGAATTGGGGTGCCTCCGTGGAAGACTTACAGGGTTAAGAGAGACCACAGAAAATAA
TTCTATGAGCTCTCCATTTCGGTCACTTCAGCAGCAAACATGTCTTGCCCATCGGTCTCA
CTTTGTTTTCTTCAACCACCCTAAAAGGTGTGATAACATCACTGATCTCTTCCTTAACCA
GCAACAGTATGTTAATGTAATATAGATGATCTGTCCACAGATTCTGTGCTACTTGACTAC
ACCCATCATAACAAACAAAGATGTTTGAAAACACCAGCAGGTGCTAAAATATCTAGTTAA
AGTTATTCAGTAGGAGTATTAGACACATAAAGACCCAATTACAGAATTTGTTGAATGATT
ATCTGTTAACGTTGGGTTTGATGGAGCTCCAAAAAAGCTGAGGAACTGTGAGTCAGTACT
TGGGAATCACTTCTTCTTGGTGGGTTGTTTTGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKF
LQGK.DLLSDT..V.FAM.V.KNLYSD.I.HAL.E.RTT.VAQLKQLQAE.EP.V..F.DPETTRQM.ST..G..LFD.L.DKH.FRQ.YLDTLYR.AK.
Retrocopy
LQGKFDLLSDTDVVGFAMNVCKNLYSDNILHALKE*RTTAVAQLKQLQAEMEPMVNRF-DPETTRQMGSTSNGQRLFD*LMDKHDFRQ*YLDTLYRHAKV


Parental protein
QYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLAS-EILMQNWDAAMEDL-TRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDL
QYECGNY.GAA..LYFFRVLVPATDRN.L.SLW.KLAS..ILM.NW.A..EDL.T.L.ET..NNS.SSP..SLQQ.T.L.H.S.FVFFNHPK..DNI.DL
Retrocopy
QYECGNYPGAAV*LYFFRVLVPATDRNVLNSLWEKLAS/QILMWNWGASVEDL/TGLRETTENNSMSSPFRSLQQQTCLAHRSHFVFFNHPKRCDNITDL


Parental protein
FLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLE
FL.Q.QY.N.I...CP.IL.YLTT..ITNKDV.K..QVLK.LVKVIQ.E..T.KDPITEFVE.L.VN..FDGA.KKLR.CESVL.N.FFLV.C.E
Retrocopy
FLNQQQYVNVI*MICPQILCYLTTPIITNKDV*KHQQVLKYLVKVIQ*EY*THKDPITEFVE*LSVNVGFDGAPKKLRNCESVLGNHFFLVGCFE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide