RetrogeneDB ID:
retro_mputfur_194
Organism:
Location:
AEYP01112791.1:903-1127 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
53.16 %
Coverage:
52.78 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
CCDC58
Parental gene aliases:
No gene alias available
Parental gene description:
coiled-coil domain containing 58 [Source:HGNC Symbol;Acc:31136]

Genomic region (view in browser)





>retro_mputfur_194
AAGATAAAAACAAGGTGTGCGGATGAAATATCAGCGATGGTGAAAGACCTCCCGTAAGAG
AGAAAGAGAATCGGGATGTTTTGATGTACTCAAGCTCCTTAGAAAAGAACATACAAAGTT
GAAGTGGATGCAGGGAGAACAGAGAACGGAAGAAGTTTTAAAATAGGAGGTGGAAGGTGA
TTCATGAATGTGCCCCCATTCACTTCAAGCCTCCAAAGAATGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RVIKNCIAQTSSVVKQLREEREK-NLDDLT-LLKQLRKEQTKLKWMQSELNVEEVV-NDRSWKVFNERCRIHFKPPKNE
.....C....S..VK.L..ER...N.D.L...LK.LRKE.TKLKWMQ.E...EEV..N.R.WKV..E...IHFKPPKNE
Retrocopy
KIKTRCADEISAMVKDLP*ERKR/NRDVLM/VLKLLRKEHTKLKWMQGEQRTEEVL\NRR-WKVIHECAPIHFKPPKNE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide