RetrogeneDB ID:
retro_mputfur_196
Organism:
Location:
AEYP01115611.1:531-964 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.1 %
Coverage:
91.25 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
RPL21
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L21 [Source:HGNC Symbol;Acc:10313]

Genomic region (view in browser)





>retro_mputfur_196
TTCTCTAGGCCTTTTAGAAAACATAGAATTGCTTCTTTGGCCGCTTACATGAGACTCTGT
CAGGAAAAAAGTGATGGCGTGGACATCAAGGGAATGGCACTGTTCATGAAGGGACGTCCC
ACAATATTGCTATGTTCAAAACCGGAAGAGTCCACAGTGTTACCCGGCATGCTATTGGCG
TTATTACAAACAAACAAGTTAAAGGCAAGATTCTTACCAAGAGCATTAGTGTACGTATTG
AGCATATTAAGTGCTCAAAGAGCAGAGACAACTTCCTGAAAAGGGCGAAGGAAAATGATC
AGATGCAAGCCAAAGAGAAAGGTACTTGGGTTCAGTGGAAACACCAGCTGGCCCCACCCA
GAGAAACCTGCTATGTGAGAGCTGATGGAAGGAGCCGGAGCTGCCTAAGCCCATCCCTTG
GGAATGCAAGGCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FSRPFRKHGVVPLATYMRI-YKKGDIVDIKGM-GTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKEN
FSRPFRKH....LA.YMR....K.D.VDIKGM.GTV..G..H.....KTGRV..VT.HA.G...NKQVKGKIL.K.I.VRIEHIK.SKSRD.FLKR.KEN
Retrocopy
FSRPFRKHRIASLAAYMRLCQEKSDGVDIKGM/GTVHEGTSHNIAMFKTGRVHSVTRHAIGVITNKQVKGKILTKSISVRIEHIKCSKSRDNFLKRAKEN


Parental protein
DQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNG-KEPELLEPIPYEFMA
DQ....AKEKGTWVQ.K.Q.APPRE...VR..G.KEPEL..PIP.E..A
Retrocopy
DQ--MQAKEKGTWVQWKHQLAPPRETCYVRADG/KEPELPKPIPWECKA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide