RetrogeneDB ID:
retro_mputfur_197
Organism:
Location:
AEYP01117409.1:177-1005 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
81.43 %
Coverage:
65.64 %
Frameshifts:
3
Stop codons:
4


Parental gene:
Parental gene symbol:
DCTN2
Parental gene aliases:
No gene alias available
Parental gene description:
dynactin 2 (p50) [Source:HGNC Symbol;Acc:2712]

Genomic region (view in browser)





>retro_mputfur_197
GCAAAACTGCTGGCCACCCTGAAGCAGCAGCTGTTGCTTCCCACCTGGAGAAGCTGCTGG
GACCAGATGCAGCCATCGACCTTACTGACCCTGATGGAGCTCTGGCTAAGTGCTTGTGCT
GCAGCTGGAAACCATCAAAAATAGCAAAGGAACCAGTTCAAGGGGAAAGACCACAGCGGG
ACTCCTGTAGATAGTAGCCTCGTCACTTACGGACTACATTCTCAACCTGAATAGGACAAG
TTGTCTCAAGCTGCTGAAGTTACAGAACTTGAGAAGTGCCTGACAGAGCTGGAAGCAACT
GTACACTGTGATCAGGATGCTCAGAATCCCCTTTAAGCAGGTGTTCAGGGATCCTGTCTC
ATGGAGACTGTAGAACTATTGCAAGTAAAGGTGAACGCCCTGGACCTCGCAGTTTTGGAC
CAAGTGGAGGCTCGGCTGCAGAGTGTCCTGGGAAAGAAGAATGAAATTGCCAAGCATAAA
GCTTCTGTATAAGATGCAGATGCACAAAGCAAGGTGCACCAGCTATTTGGCACTGTACAG
GGATGGAGCCCCATTTCCTACCCCCTTCCTGGGCTGGTGCAGAGACTTTTCACCACCAAG
CAGCTGCATGAGCAAGCCATGCAGTTTGGTCACCTCCTGACTCACTTGGATACTACAAAC
CAGATGATTGCTAGCTCTCTCAAGGACAACACCACCCTCCTGACCCAGATGCAGACAACT
GTGCATGAGAACCTGTCCACGGTTGAGGGGAATTTTGCCAACATTGACAAACAGATGAAG
AAACTGGGAAAGTGAGCACCTTTAGGAGACGGAGAACGAGGGCAATCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AKQLAALKQQL-VASHLEKLLGPDAAINLTDPDGALAKRL-LLQLEATKNSKGTGSGGKTT-SGTLVDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTE
AK.LA.LKQQL.VASHLEKLLGPDAAI.LTDPDGALAK.L..LQLE..KNSKGT.S.GKTT.SGT.VDSSLVTY.LHS.PE.DK.SQAA.V.ELEK.LTE
Retrocopy
AKLLATLKQQL/VASHLEKLLGPDAAIDLTDPDGALAKCL/VLQLETIKNSKGTSSRGKTT/SGTPVDSSLVTYGLHSQPE*DKLSQAAEVTELEKCLTE


Parental protein
LEATVRCDQDAQNPLSAGVQGACLMETVELLQAKVNALDLAVLDQVEARLQSVLGKVNEIAKHKASVEDADTQSKVHQLYDTVQRWSPIASTLPELVQRL
LEATV.CDQDAQNPL.AGVQG.CLMETVELLQ.KVNALDLAVLDQVEARLQSVLGK.NEIAKHKASV.DAD.QSKVHQL..TVQ.WSPI...LP.LVQRL
Retrocopy
LEATVHCDQDAQNPL*AGVQGSCLMETVELLQVKVNALDLAVLDQVEARLQSVLGKKNEIAKHKASV*DADAQSKVHQLFGTVQGWSPISYPLPGLVQRL


Parental protein
VTIKQLHEQAMQFGQLLTHLDTTQQMIASSLKDNTTLLTQVQKTMRENLSTVEGNFANIDERMKKLGKTARAGPGRQRDS
.T.KQLHEQAMQFG.LLTHLDTT.QMIASSLKDNTTLLTQ.Q.T..ENLSTVEGNFANID..MKKLGK.A..G.G....S
Retrocopy
FTTKQLHEQAMQFGHLLTHLDTTNQMIASSLKDNTTLLTQMQTTVHENLSTVEGNFANIDKQMKKLGK*APLGDGERGQS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide