RetrogeneDB ID:
retro_mputfur_199
Organism:
Location:
GL896898.1:921041-922249 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
96.29 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
RPL3
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L3 [Source:HGNC Symbol;Acc:10332]

Genomic region (view in browser)





>retro_mputfur_199
ATGTCTCACAGGAAATTCTCCGCTCCCAGGCACGGGTCCCTGGGGTTCTTGCCTCTGAAA
CGCAGTAGCCGGCACCGTGGGAAGGTGAAGAGCTTCCCCAAGGATGACTCTTCCAAGCCT
GTTCATCTCACAGCCTTCCTGGGCTACAAGGCCAGCATGACTCACATCGTGCGGGAGGTG
GACAGGCCAGGATTCAAGGTGAACAAGAAGGAAGTTGTGGAGGCTGTGACCATTGTGGAG
ACACCACCCATGGTGGTTGTGGGCATCATGGGCTACGTGGAAACCCCTCGAGGCCTCCGT
ATCTTTAAGACCATCTTTGCTGAGCACATCAGTGATGAATGCAAAAGGCGCTTTTATAAG
AACTGGCATAAGTCTAAGAAGAAGGCCTTCACCAAGTACTGTAAGAAGTGGCAGGATGAT
GATGGCAAAAGCAACTCGAGAAGGACTTCAACAGCATGAAGAAGTACTGCCAGGTGATCC
GGGTCATTGCCCACACCCAGATGCGTCTGCTTCCTCTGCGCCAGAAGAAGGCCCACCTCA
TGGAGATCCAGGTGAACGGAGGCACAGTGGCTGAGAAGCTGGACTGGGCCCGGGAGAGGC
TGGAGCAGCAGGTGCCTGTGAACCAAGTGTTTGGGCAGGACAAGATGATCGATGTCATTG
GTGTCACCAAGGGCAAAGGCTACAAAGGGGTCACCAGCCGCTGGCACACCAAGAAGCTAC
CCCGCAAAACCCACCGGGGCCTGCACAAGGTTGCGTGTATTGGGGCTTGGCATCCTGCCC
GCGTGGCCTTCTCTGTGGCTCAGGCTGGGCAGAAAGGCTACCATCACCACACAGAGATCA
ACAAGAAGATCTACAAGATTGGCCAGGGCTACCTCATCAAGGATGACAAGCTGATTAAGA
ACAATGCCTCCACCGACTACGATCTGTCTGACAAGAGCATCAACCCCCTGGGTGGTTTTG
TCCACTATGGTGAAGTGACCAATGACTTCATCATGCTGAAGGGCTGTGTGGTGGGAACCA
AGAAGCGAGTGCTTACGCTCTGCAAGTCCTTGCTGGTACAGACCAAATGGCGGGCCCTAG
AGAAGATCGACCTTAAGTTCATTGACACCACCTCCATGTTTGGCCATGGCCGATTCCAGA
CGGTGGAGGAGAAGAAAGCGTTCATGGGACCACTTAAGAAAGACCGAATTGCAAAGGAAG
AAGGAGCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDSSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLR
MSHRKFSAPRHGSLGFLP.KRSSRHRGKVKSFPKDDSSKPVHLTAFLGYKA.MTHIVREVDRPG.KVNKKEVVEAVTIVETPPMVVVGI.GYVETPRGLR
Retrocopy
MSHRKFSAPRHGSLGFLPLKRSSRHRGKVKSFPKDDSSKPVHLTAFLGYKASMTHIVREVDRPGFKVNKKEVVEAVTIVETPPMVVVGIMGYVETPRGLR


Parental protein
TFKTIFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDDDGK-KQLEKDFNSMKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARE
.FKTIFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDDDGK.KQLEKDFNSMKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARE
Retrocopy
IFKTIFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDDDGK/KQLEKDFNSMKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARE


Parental protein
RLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLI
RLEQQVPVNQVFGQD.MIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGL.KVACIGAWHPARVAFSVA.AGQKGYHH.TEINKKIYKIGQGYLIKD.KLI
Retrocopy
RLEQQVPVNQVFGQDKMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLHKVACIGAWHPARVAFSVAQAGQKGYHHHTEINKKIYKIGQGYLIKDDKLI


Parental protein
KNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTVEEKKAFMGPLKKDRIAK
KNNASTDYDLSDKSINPLGGFVHYGEVTNDF.MLKGCVVGTKKRVLTL.KSLLVQTK.RALEKIDLKFIDTTS.FGHGRFQTVEEKKAFMGPLKKDRIAK
Retrocopy
KNNASTDYDLSDKSINPLGGFVHYGEVTNDFIMLKGCVVGTKKRVLTLCKSLLVQTKWRALEKIDLKFIDTTSMFGHGRFQTVEEKKAFMGPLKKDRIAK


Parental protein
EEGA
EEGA
Retrocopy
EEGA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide