RetrogeneDB ID:
retro_mputfur_20
Organism:
Location:
GL897085.1:886765-887851 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
80.0 %
Coverage:
82.9 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
SEPHS1
Parental gene aliases:
No gene alias available
Parental gene description:
selenophosphate synthetase 1 [Source:HGNC Symbol;Acc:19685]

Genomic region (view in browser)





>retro_mputfur_20
GGCCTGGGGGCGGCCCGCGAAGAGCCGGCGCAGGAGGGAGGCCTGGCGGCCGGGGCCGAG
CCCAGCGCCCCGTCTCCGGCCCTGGGCATTGGGATGGACTCGTGCGTCGTCCCGCTGAGG
CACGGGGGCCTGTCGCTGGTGCAGACCACGGACTTCTTTTACCCCCTGGTGGAGGATCCC
TACATGATGGGGCGCATAGCCTGCGCCAACGTGCTGAGCGACCTGTACGCCATGGGCATC
ACCGAGTGTGACAACATGCTGATGCTGCTCAGCGTCAGCCAGAGCATGACGGACGAGGAG
CGGGAGAAGGTCACGCCGCTGCTGATCCGGGGCTTCCGCGACGCCGCCGAGGAGGGAGGC
ACCGCCGTGACCGGGGGGCAGACGGTGGTAAACCCTTGGGTTATCGTCGGGGGGGTTGCC
ACTGTGGTGTGCCAGCCCAGCGAGCTCATCATGCCCGACAGCGCGGTCGTGGGGGACGTG
CTCGTGCTGACCAAACCCTTAGGAACGCAGGTCGCGGTCAACGCCCACCAGTGGCTGGAC
AGCCCCGAGCGATGGAGTAAAGTCAGTATGGTGGTGTCCAGGGAGGAGGTGGAGCTGGCC
TACCAGGAGGCCATGTTCAGCATGGCGACGCTGAACAGGACGGCCGCCGCCTTGATGCAC
ACGTTTAACGCGCACGCGGCCACCGATGTCACCGGCTTCGGCATCCTGGGACACTCTCAG
AACCTGGCCAAGCAGCAGAGAAACGAGGTGTCGTTTGTGATTCATAATCTGCCCATTATT
GCCAAGATGGCAGCCATCAGCAAGGCCAGCGGGCGCTTCGGGCTCCTTCAGGGGACCTCG
GCGGAAACCTCCGGGGGATTGCTGATTTGTCTGCCAAGAGAACAGGCAGCTCGCTTTTGC
TCCGAAATCAAATCTTCCAAGTACGGAGAGGGCCACCAGGCATGGATCGTCGGGATTGTG
GAGAAGGGAAACCGGACAGCCCGGATCATTGACAAGCCTCGAGTTATTGAGGTCCTACCT
CGGGGGGCTACTGCTACTGCTCTGGCTCCTGACAATTCCAGTGCCGCCTCTGAGCCGAGT
TCATGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AVMPRLGIGMDTCVIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGISNKMTDRERDKVMPLIIQGFKDAAEEAGTS
A..P.LGIGMD.CV.PLRHGGLSLVQTTD..YP.V.DPYMMGRIACANVLSDLYAMG.TECDNMLMLL..S..MTD.ER.KV.PL.I.GF.DAAEE.GT.
Retrocopy
APSPALGIGMDSCVVPLRHGGLSLVQTTDFFYPLVEDPYMMGRIACANVLSDLYAMGITECDNMLMLLSVSQSMTDEEREKVTPLLIRGFRDAAEEGGTA


Parental protein
VTGGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEAMMNMARLNRTAAGLMHTF
VTGGQTV.NPW...GGVAT.VCQP.E.IMPD.AV.GDVLVLTKPLGTQVAV..HQWLD.PE.W.K...VV..E.VELAYQEAM..MA.LNRTAA.LMHTF
Retrocopy
VTGGQTVVNPWVIVGGVATVVCQPSELIMPDSAVVGDVLVLTKPLGTQVAVNAHQWLDSPERWSKVSMVVSREEVELAYQEAMFSMATLNRTAAALMHTF


Parental protein
NAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVE
NAHAATD.TGFGILGH.QNLAKQQRNEVSFVIHNLP..AKMAA.SKA.G..FGL..GT..ETSGGLLICLPREQAARFC.EIKS.KYGEGHQAWI.GIVE
Retrocopy
NAHAATDVTGFGILGHSQNLAKQQRNEVSFVIHNLPIIAKMAAISKASGR-FGLLQGTSAETSGGLLICLPREQAARFCSEIKSSKYGEGHQAWIVGIVE


Parental protein
KGNRTARIIDKPRIIEVAPQ
KGNRTARIIDKPR.IEV.P.
Retrocopy
KGNRTARIIDKPRVIEVLPR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide