RetrogeneDB ID:
retro_mputfur_201
Organism:
Location:
GL896898.1:23682971-23683897 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
77.74 %
Coverage:
86.8 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
SORD
Parental gene aliases:
No gene alias available
Parental gene description:
sorbitol dehydrogenase [Source:HGNC Symbol;Acc:11184]

Genomic region (view in browser)





>retro_mputfur_201
ATGGAGGTGGCCAAGCCTGAGAAACTCTCTCTTGTGGTGCACAGACCTGGAGACCTGAGC
CTGGACAACTATCCTATCCCTGAACCAGGCCCAAATGAACTGTTGCTGAAGACACATTCT
GTTGGGATCTGTGGCTCAGATGTCCACTACTGGCAGCATGGTCGAATTGGCCATTTTATT
GTGGAAAAGCCAGTGGTGCTGGAGCATGAAGCTTCAGGGACAGTCATAAAAGTGGGATCA
CTGTTCAAGCACCTAAAGCCAGAGGATCGTGTTGCCACAGAGCCTAGCTCTCTGCGAGAA
ATGGATGAACTTTGTAAGATTAGCAGGTATAATCTGTCACCATCCATCTTCTTCTATGCC
ACGCCCCCTGATGACAGGAACCTCTACTGGTTTTATAAACACAACGCTGACTTCTGCTAC
AAGCTTCCTGACAATGTCACCTTTGAAGAGGGGGTGCTGATTGAACCACTGTCTGAGGGG
ATCCATGCCTGCCGGCAAGCTGGAATCACCCTGAGGAACAGGGTCTTTGTGTGTGGAGCT
GGGCCATGGGACTGTTCATTCTGATCATGGCCAAGGCAATGGCTGCAGCTCAAGTGCTGG
TGACTCATCTGTCTGCTTCTCAGTTGTCTAAAGCTAGGGAAGTTGGGCCTGATATTGTCC
TCCAGATCTCCAAAGACAGCCCTAAGGAAATTGTCAGTAAAGTGAAAGATCTGCTGGGGT
GCAAGCGAAAAGTGACCATCATGTTCCCAGGAGCGGGGCCCACCATCCACTCAAGCATTG
ATGCTTCTCATTCTGATGGGACCCTGGTGCTCGTAGCGCTGGGCTCTGAGATGAGCCCTG
TGCCCCCAGTGCACGCTGCCATCCAGGAGATGGATATTAAGGTTATGTTTCAATATTGCA
ACACATGGCCAATGGCGATTTTGATG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAAAKAENLSLVVHGPGDLRLENYPIPEPGPNEVLLKMHSVGICGSDVHYWQHGRIGDFIVEKPMVLGHEASGTVVKVGSLVKHLKPGDRVAIEPGALRE
M..AK.E.LSLVVH.PGDL.L.NYPIPEPGPNE.LLK.HSVGICGSDVHYWQHGRIG.FIVEKP.VL.HEASGTV.KVGSL.KHLKP.DRVA.EP..LRE
Retrocopy
MEVAKPEKLSLVVHRPGDLSLDNYPIPEPGPNELLLKTHSVGICGSDVHYWQHGRIGHFIVEKPVVLEHEASGTVIKVGSLFKHLKPEDRVATEPSSLRE


Parental protein
MDEFCKIGRYNLSPSIFFCATPPDDGNLCRFYKHNADFCYKLPDNVTFEEGALIEPLSVGIHACRRAGITLGNKVFVCGAGP-IGLVTVIVAKAMGAAQV
MDE.CKI.RYNLSPSIFF.ATPPDD.NL..FYKHNADFCYKLPDNVTFEEG.LIEPLS.GIHACR.AGITL.N.VFVCGAGP..GL...I.AKAM.AAQV
Retrocopy
MDELCKISRYNLSPSIFFYATPPDDRNLYWFYKHNADFCYKLPDNVTFEEGVLIEPLSEGIHACRQAGITLRNRVFVCGAGP/MGLFILIMAKAMAAAQV


Parental protein
LVTDLSASRLSKAKEVGADNVLQISKESPKEIASKVESLLGCKPEVTIECTGAEPAIQSGIYATRSGGTLVLVGLGPEMTTVPLVHAAIREVDIKGVFRY
LVT.LSAS.LSKA.EVG.D.VLQISK.SPKEI.SKV..LLGCK..VTI...GA.P.I.S.I.A..S.GTLVLV.LG.EM..VP.VHAAI.E.DIK..F.Y
Retrocopy
LVTHLSASQLSKAREVGPDIVLQISKDSPKEIVSKVKDLLGCKRKVTIMFPGAGPTIHSSIDASHSDGTLVLVALGSEMSPVPPVHAAIQEMDIKVMFQY


Parental protein
CNTWPMAISM
CNTWPMAI.M
Retrocopy
CNTWPMAILM


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide