RetrogeneDB ID:
retro_mputfur_204
Organism:
Location:
GL896898.1:37576891-37577582 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
66.11 %
Coverage:
57.21 %
Frameshifts:
5
Stop codons:
4


Parental gene:
Parental gene symbol:
ARRB2
Parental gene aliases:
No gene alias available
Parental gene description:
arrestin, beta 2 [Source:HGNC Symbol;Acc:712]

Genomic region (view in browser)





>retro_mputfur_204
ATATCCCAGAATCTGCCCTGGTTCATCATACTGCAGCCAGGCCCAGAGGACACAGGGAAG
GCCTGTACAGCAGACTCTGAGATTTGAGCCTTCTCTGCCAAATTGTTAGAAGAGAAAAAA
CACCAAAGAAGGTCCATACATCTGGTGATCTGAAAGGTGCAACTTGCCCCAGAGAAACTA
GGCCCCAGCCTTCAGTAGAAACCACCCACCACATCATATCTGACCAGCCCTGCACCTTGA
GACTTCCATGGACAAGGCTCTGAACGATCATGGGGAGCCTCTACGTGTCAATGTCCATGT
CACCAACATCTCCATCCAGACCATCAAGGAAATCAAAGTCTCTCTGAGATAACATGTGAC
ATCTGCCTCTTCTGCTACCCAGGATAAGTGTCCTGTGACTCATATCGAACAAAATGACCA
GGTATCACCCAGCTCCCTGTTCTGAAGGTGTATACCATCACCCCGCGGCTGAGTGACAAC
TGGAAGAAGCATGGTCTTGTCCTGGAAGAGTATCTCAAGCATGAGAACACCAACCTGGCT
TCCAGCACCATTGTGTAGGAGGCTGCCAACAAGGAGGTGCTGGAATCCTGATGTCCTACA
GGGTCAAGGTGAGCTGGTGGTGTCACATGGTGGGGTAGCCTCTGTGGAGCTGCCTTTTGT
TTTTATACACCGCAAACTCCACCACCACATC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPGP-QPSAETTRHFLMSDR-SLHLEASLDKELYYHGEPLNV
I.QNLP....LQPGPEDTGKAC..D.EI.AF.AK.LEEK.H.R.S..LVI.KVQ.APEK.GP.QPS.ETT.H...SD...LHLE.S.DK.L..HGEPL.V
Retrocopy
ISQNLPWFIILQPGPEDTGKACTADSEI*AFSAKLLEEKKHQRRSIHLVI*KVQLAPEKLGP/QPSVETTHH-IISDQ/ALHLETSMDKALNDHGEPLRV


Parental protein
NVHVTNNSTKTIKKIKVSVRQYADICLFSTAQYKCPVAQIEQDDQVSPSSTF-CKVYTVTPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGATKEVL
NVHVTN.S..TIK.IKVS.R.........T.Q.KCPV..IEQ.DQVSPSS.F..KVYT.TP.LSDN..K.GL.L...LKHE.TNLASSTIV.E.A.KEVL
Retrocopy
NVHVTNISIQTIKEIKVSLR*HVTSASSAT-QDKCPVTHIEQNDQVSPSSLF/LKVYTITPRLSDNWKKHGLVLEEYLKHENTNLASSTIV*EAANKEVL


Parental protein
-GILVSYRVKV-KLVVSRGGDVSVELPFVLMHPKPHDHI
.GIL.SYRVKV..LVVS.GG..SVELPFV..H.K.H.HI
Retrocopy
/GILMSYRVKV/ELVVSHGGVASVELPFVFIHRKLHHHI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide