RetrogeneDB ID:
retro_mputfur_206
Organism:
Location:
GL896898.1:40663147-40663471 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
55.45 %
Coverage:
60.8 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
UBALD1
Parental gene aliases:
No gene alias available
Parental gene description:
UBA-like domain containing 1 [Source:HGNC Symbol;Acc:29576]

Genomic region (view in browser)





>retro_mputfur_206
ATGTTGGCGAAAGTGGACCACCTATGGCACCAGGTCATGATCAACCAATTTATGCTGGCT
GTAGGTTGCACTGCCAACCAGGTGAACAGCTCCAACAGGTGCTAGAGATTGCACTGGCAG
CAAGAGATTGCCCTGAGTGGTTTTCTCCAAGAAACCACCATTCCCATCAGCTACCATCAC
CACCAGATGATGTGCACCCCCAGCAAAACACCTGCCATACCACCCAACTTTCCTGATGCA
CTGGCCATGTTCCCTAAGCTACATGCTTCTGAGATCCGTCAGAGCAGCAACATCCCCATG
ACAGCTGTGGTCTCCTCCTCTCCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSVNMDELKHQVMINQFVLTAGCAADQAKQLLQA--AHWQFETALSAFFQETNIPYS-HHHQMMCTPANTPATPPNFPDALTMFSRLKASESFHGGGSGS
M....D.L.HQVMINQF.L..GC.A.Q..........HWQ.E.ALS.F.QET.IP.S.HHHQMMCTP..TPA.PPNFPDAL.MF..L.ASE......S..
Retrocopy
MLAKVDHLWHQVMINQFMLAVGCTANQVNSSNRC*RLHWQQEIALSGFLQETTIPISYHHHQMMCTPSKTPAIPPNFPDALAMFPKLHASEIRQ--SSNI


Parental protein
PMATTATSPP
PM.....S.P
Retrocopy
PMTAVVSSSP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide