RetrogeneDB ID:
retro_mputfur_207
Organism:
Location:
GL896898.1:43106489-43106785 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
59.05 %
Coverage:
95.41 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
NADH dehydrogenase 1 beta subcomplex subunit 2, mitochondrial-like protein [Source:UniProtKB/TrEMBL;Acc:G9KCY4]

Genomic region (view in browser)





>retro_mputfur_207
CTATCAGCTCTGACATGGCCGGCACTTTCTGTTGGTATCAAAGGCCACTTCTTCAGAGGT
CACCACTCATGGGTGGTTGGAGGCAGTGGGGTCCGTCATGCTGGTTGTGGTGTGCATATT
GAAGCCCAGCATAGATAGCTTCCCCAACTGATCAGATCCCAGGTGACCCAGGCTAAGTTC
TTCAGCGGACCATGGGGTTCTGGTTTCCCTGGTCAGAGGCTATGCTGGGTCACTTTCCTT
ATCTAGATCCTTCCCGGTGAGCAGATGAAGAACTGGGTATCCTTCCAGATGACAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSALTRLAPFVRAGGRLFRGPGSRAAGGSGVRHAGGGVHIEPRYRQFPQLTKSQVIQAEIFSG-TMWFWILWRFWHDSDAVLGHFAYPDPSQWTDEELGI
.SALT..A..V...G..FRG..S...GGSGVRHAG.GVHIE...R..PQL..SQV.QA..FSG.TM.F...W..W..S.A.LGHF.Y.DPS...DEELGI
Retrocopy
LSALTWPALSVGIKGHFFRGHHSWVVGGSGVRHAGCGVHIEAQHR*LPQLIRSQVTQAKFFSG/TMGF---WFPW--SEAMLGHFPYLDPSR*ADEELGI


Parental protein
LPDDE
LPDD.
Retrocopy
LPDDK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide