RetrogeneDB ID:
retro_mputfur_210
Organism:
Location:
GL896898.1:49677645-49678563 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.35 %
Coverage:
62.45 %
Frameshifts:
3
Stop codons:
5


Parental gene:
Parental gene symbol:
AP5M1
Parental gene aliases:
No gene alias available
Parental gene description:
adaptor-related protein complex 5, mu 1 subunit [Source:HGNC Symbol;Acc:20192]

Genomic region (view in browser)





>retro_mputfur_210
TTGGCTCAGTGGACAGTGTGGCTCATAGCCATGAACCAGGATCTCCACATTGTGGCACCA
TCATATTCTCCAGATGATATCCCACTCTTGGAAAATGAGCTAAGGTCTTCAATGGAGTAA
ATTATATGCCTATTCCCAAAGATGGTCCCTTTCTTAAAGCACTACTCTTTGAAGTTAGAT
TATTGGATGATGATAAGAACTTAATACAGAGTCATGATAACTGGTTCACACACAATAAAA
CATCTGTTTATGGTCTCCTAAGAGGTGGAGAACTCTGGAAAGTTGTTGCTTTTCTGAAGA
ATAACATGATATATGTTTATGTTCCACTGTTGAATAAGCTGTATCTCCTCATCCACCATT
AATTCACGTTAGTGGAATTTCACAAGGCTCTTTTCTTTTAGAGGTAACATTGATATATAT
ATTTTTTTACTTGGGACAGAAAAAAGACACTGAGCTAAATACAAAATTGAACCAATTGCT
TGATTTACTTCTACAAAATTGTCCATTGGAATTTTCTTGGATGCCAACCTACAGAACTCA
CTGGGTAGTGCTAGTCTTGTTTCTGTGATGCATCTATAAAAGCAGCCAGCCTGGAAAGTT
AGAACCTACAAAGGAAAACCACAAGTTTCTATTTCTATCACTGAAAAGGTAAAATCCATA
CAATATGATAAATAGGATATAGCAGATACAAGGCAAGTCTTTGGAGCTATCATTTTCAAG
TGCGATTTAGAAAGAATCATGCCAAACGTTACAATCAGCTTGAGTCTCCCCACCAATGGA
TCTCCACTTCAGAATATTCTAGTTCATCCTTGTGTGACTTCTCTTGACCTTGGCATTCTG
ACTTGTAGTAGCATTGATGCAATGGATGATTCTGCACTTAGTGTACCTTACAAATTTCCA
TTCACTCTTCCTTTAGAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAQRAVWLI-SHEPGTPLCGTVRFSRRYPTVEKRARVFNGTSYVPIPEDGPFLKALLFELRLLDDNKDFVESRDSCSHINKTSVYGLVIGGGELWPVVAF
.AQ..VWLI.SHEPG.P.CGT..FSR.YPT..K.A.VFNG..Y.PIP.DGPFLKALLFE.RLLDD.K....S.D.....NKTSVYGL...GGELW.VVAF
Retrocopy
LAQWTVWLI/SHEPGSPHCGTIIFSR*YPTLGK*AKVFNGVNYMPIPKDGPFLKALLFEVRLLDDDKNLIQSHDNWFTHNKTSVYGL-LRGGELWKVVAF


Parental protein
LKNNMIYACVPL-VEQTLSPHPPLISISGISQ-SFEL-LFGIQDFLFLGQKNDTELNTKLNQLPDLFLQACPF-GTLLDANLQNSLDSINFASVPHPQKQ
LKNNMIY..VPL.VE...SPHPPLI..SGISQ.SF.L....I..F..LGQK.DTELNTKLNQL.DL.LQ.CP..G..LDANLQNSL.S....SV.H..KQ
Retrocopy
LKNNMIYVYVPL/VE*AVSPHPPLIHVSGISQGSFLLEVTLIYIFFYLGQKKDTELNTKLNQLLDLLLQNCPL/GIFLDANLQNSLGSASLVSVMHL*KQ


Parental protein
PAWRVGTYKGKPQVSISITEKVKSMQYDKQDIADTWQVVGAVTCKCDLEGNMPNVTISLSLPTNGSPLQDILVHPCVTSLDSAILTSSSIDTMDDSAFSG
PAW.V.TYKGKPQVSISITEKVKS.QYDK.DIADT.QV.GA...KCDLE..MPNVTISLSLPTNGSPLQ.ILVHPCVTSLD..ILT.SSID.MDDSA.S.
Retrocopy
PAWKVRTYKGKPQVSISITEKVKSIQYDK*DIADTRQVFGAIIFKCDLERIMPNVTISLSLPTNGSPLQNILVHPCVTSLDLGILTCSSIDAMDDSALSV


Parental protein
PYKFPFTPPLE
PYKFPFT.PLE
Retrocopy
PYKFPFTLPLE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide