RetrogeneDB ID:
retro_mputfur_214
Organism:
Location:
GL896898.1:20038414-20038786 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
58.73 %
Coverage:
78.75 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
Mrpl30
Parental gene aliases:
No gene alias available
Parental gene description:
mitochondrial ribosomal protein L30 [Source:MGI Symbol;Acc:MGI:1333820]

Genomic region (view in browser)





>retro_mputfur_214
AGGCCTGCCGGAGGACGACTCTCCGTGACAAAAGGTGTGGAGTCCCTCGTGTGTACAGAT
TGGATTCCTCCCTCATTTTCTGGGTCTAGAATCCCAGAGAAAGTGTTTCCGCCTTCGCCT
GCAGACCATGAAAACTATGACGCAGAGCCACGGCCCCTTCATAAACTGCACACTATTACC
AGAATAAAAAGTACAAGACGTCCAGAGTGCGGGAAAGACACCATGAAGACACTTGAATAA
GAAAAAGCACATACTCAAGCTCACAACAACCTCCCTCCGGGGAATGCAAAACTGAAAGCG
GTGGAGCTTCCGGCAACAGTCAAGCCCCGGAAGTTGCCGCAGGGACTTCCGGCAGCGGAA
GCCGCGAGTTCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RPPGRLQMMTKGMESLIYMDWIRHKFTKSRIPDKVFQPSPADHEKYGGDPQHPHKLHIVTRIKSTKRRPYWEKDTIKMLGLEKAHTPQVHKNIPSVNAKL
RP.G.....TKG.ESL...DWI...F..SRIP.KVF.PSPADHE.Y...P...HKLH..TRIKST.RRP...KDT.K.L..EKAHT.Q.H.N.P..NAKL
Retrocopy
RPAGGRLSVTKGVESLVCTDWIPPSFSGSRIPEKVFPPSPADHENYDAEPRPLHKLHTITRIKST-RRPECGKDTMKTLE*EKAHT-QAHNNLPPGNAKL


Parental protein
KVVKHLIRIKPLKLPQGLPAEEDMSN
K.V......KP.KLPQGLPA.E..S.
Retrocopy
KAVELPATVKPRKLPQGLPAAEAASS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide