RetrogeneDB ID:
retro_mputfur_217
Organism:
Location:
GL896898.1:31694348-31694555 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
65.22 %
Coverage:
58.47 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
C19orf70
Parental gene aliases:
No gene alias available
Parental gene description:
chromosome 19 open reading frame 70 [Source:HGNC Symbol;Acc:33702]

Genomic region (view in browser)





>retro_mputfur_217
CCCCCAGCCATGGACCACTTCAGCCAGTACTTGTGTGAGCAGACCAGCCTGAAGATACCC
TGGCTCCCAGTCTCTCCAAAGTTTATCTCTCACATCCACAAGTCCTGGAATTCAGGCATC
ATTATGCTGATGTTTTTTCTCTCATTGGCCCCCTCCAAGACCCAGGAGTACTCCAAGGAG
AGCTGGGGATACCTGAAGGGGCAAACC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PPAMYQFSQYVCEQTGLKMPQLPAPPKFNFHIRDTWNSGIITVMSALSVAPSKACEYSKEGWEYLKERT
PPAM..FSQY.CEQT.LK.P.LP..PKF..HI...WNSGII..M..LS.APSK..EYSKE.W.YLK..T
Retrocopy
PPAMDHFSQYLCEQTSLKIPWLPVSPKFISHIHKSWNSGIIMLMFFLSLAPSKTQEYSKESWGYLKGQT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide