RetrogeneDB ID:
retro_mputfur_218
Organism:
Location:
GL896898.1:32306437-32306722 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
59.18 %
Coverage:
69.06 %
Frameshifts:
2
Stop codons:
4


Parental gene:
Parental gene symbol:
Rps17
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S17 [Source:MGI Symbol;Acc:MGI:1309526]

Genomic region (view in browser)





>retro_mputfur_218
AACAAGCACCTGTGCAAGGGGTTCACCATTATTCCCAGTGAGAATGTCTGAAACAAGGTT
AGCAGGCTATGGCACTCATCAGATGAAGGGGGTTTAGAGTGGTCTTCTGAGAATTATCCC
CATATTGTTGCAGAAGAAGGAGAGAGAAAGAGATAATGATGTTCCTGAGTCTCAGCACTA
GATCAGGAGGTCATTTAAGTAGGTTCTGACACTTAGGAAATGCTGAAGCTCTTGAACTAT
AGCAGTCTGTCCAGACTTCAGGTTACTCAGCTCAGAGTTGTAATG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NKRVCEEIAIIPSKKLRNKI-AGYVTHLMKRIQRGPVRGISIKLQEEERERRDNYVPE-VSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVGM
NK..C....IIPS....NK..AGY.TH.MK....G..R.I.I.LQ..ERER.DN.VPE.VSALDQE.I.V..DT.EMLKLL...SLS.LQVTQ..V.M
Retrocopy
NKHLCKGFTIIPSENV*NKV\AGYGTHQMKGV*SGLLRIIPILLQKKERER-DNDVPE/VSALDQEVI*VGSDT*EMLKLLNYSSLSRLQVTQLRVVM


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide