RetrogeneDB ID:
retro_mputfur_223
Organism:
Location:
GL896898.1:47431885-47432212 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.61 %
Coverage:
59.89 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
PEBP1
Parental gene aliases:
No gene alias available
Parental gene description:
phosphatidylethanolamine binding protein 1 [Source:HGNC Symbol;Acc:8630]

Genomic region (view in browser)





>retro_mputfur_223
ATGCCAGTGGATCTCCGCAAGTTGCTCAGGCCTTTGATCCTACAGGAAGCAGACAAGATG
TTGCAGTATCCACTGTAGGTCAAACACACTAGGCCGGGGGTCAACCAGCTGGACAAAGTG
CTGATGGCTCACCAGGTTAAGAACCAGCCGACTGGTATTGTTTGGGATGGACTTGATCAA
TTCTGCACCTTGGTCTTGACAGATCCAGATGCTCTTAGAAAGGACTGTGAAGATAGGGAA
TGGCATCATTTCCTGGAGGTCAACATGAAGGGCAATGCAGTCAACAGTGACACAGTCCTC
TCTGATTATGTTGAGTCTGGGCTTCCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MPVDLSKWSGPLSLQEVDERPQHPLQVKYTGTEIDELGKVLTPTQVKNRPTSIAWDGLDSGKLYTLVMTDPDAPSRKDPKYREWHHFLVVNMKGNDISSG
MPVDL.K...PL.LQE.D...Q.PL.VK.T......L.KVL...QVKN.PT.I.WDGLD.....TLV.TDPDA..RKD...REWHHFL.VNMKGN...S.
Retrocopy
MPVDLRKLLRPLILQEADKMLQYPL*VKHTRPGVNQLDKVLMAHQVKNQPTGIVWDGLD--QFCTLVLTDPDA-LRKDCEDREWHHFLEVNMKGNAVNSD


Parental protein
TVLSDYVGSGPP
TVLSDYV.SG.P
Retrocopy
TVLSDYVESGLP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide