RetrogeneDB ID:
retro_mputfur_229
Organism:
Location:
GL896899.1:12400551-12400929 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
75.78 %
Coverage:
99.21 %
Frameshifts:
2
Stop codons:
5


Parental gene:
Parental gene symbol:
NUTF2
Parental gene aliases:
No gene alias available
Parental gene description:
nuclear transport factor 2 [Source:HGNC Symbol;Acc:13722]

Genomic region (view in browser)





>retro_mputfur_229
ATGAGAGACAAGCCAATTTGGGAGCAGACTGGATCCAACTTCATTCAACATTAATATTAG
TTATTTGATTAATGACAGAACCCCATGAAGCACAATTTATACTGAGGCATCATGTCTAAT
GTGGGAAGGACAGCAGTTCCAAGGGAAAGCTGCCATTGTGAGGAAGTTGTCTAGCCTCCA
TTCTAGAAAATGCAGCACAGCATCACAGTGCAGGATCATCAGCCCACGTAACACAGCTGC
ATCAGCAGCATCATTGTGGGCCCACTCAAGGCTGATGGAGACCCCATCATAGGCTTCCAC
CAGATGTTCCTGTTAAAGAACATCAGTGGTGCTTGGGTTTGCATCAGTGACATGTTCAGG
CTTGCTCTGCACAAATTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGDKPIWEQIGSSFIQHYYQLFD-NDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSL-PFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMG
M.DKPIWEQ.GS.FIQH.Y.LFD.NDRT....IY..ASCL.WEGQQFQGKAAIV.KLSSL.PF.K.QHSIT.QDHQPT..SCI.S..VG.LKAD.DPI.G
Retrocopy
MRDKPIWEQTGSNFIQH*Y*LFD\NDRTP*STIYTEASCLMWEGQQFQGKAAIVRKLSSL/PF*KMQHSITVQDHQPT*HSCISSIIVGPLKADGDPIIG


Parental protein
FHQMFLLKNINDAWVCTNDMFRLALHNF
FHQMFLLKNI..AWVC..DMFRLALH.F
Retrocopy
FHQMFLLKNISGAWVCISDMFRLALHKF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide