RetrogeneDB ID:
retro_mputfur_240
Organism:
Location:
GL896899.1:7239521-7239915 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
68.15 %
Coverage:
54.25 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
CENPH
Parental gene aliases:
No gene alias available
Parental gene description:
centromere protein H [Source:HGNC Symbol;Acc:17268]

Genomic region (view in browser)





>retro_mputfur_240
CAACCCAAGAAGTAAGCAGCTGCCAAGCCCTCTGACTCTGGAGTGGGAGGTGGGGAGGGT
GGGCCAGCACAGGTCTGGTGTCCAGGTGTGCATCCCAAGGACCACTTCACCCTGCTGCTC
AGGCTGAGAGCACAGGGAAAATAATAACTCCTGGACTATAAATCAGTGGTTGATGCAAAT
GAAGAAAAAGCTTTAGAACAAATCGTGCAAGATAAGCAAATTGAAGCTAAAATTGAAGAC
CTGGAAAGGGAACCTGAAGAGTTAAAAATTGCTTTTGAAATGAAAAAGGCTTGTATTAGA
TAGGATGCAACTTTGAGCTGCACTTAAAAAAACCTGGAGAAAATTAACCCCAAGTGTGCT
CATGGATAACATGAAACATGTATTAAAGCTAAAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QPGKQAATEPADSGAGGGEGEPPQVAGAQAARPEDRLTLLLRLRAQTKQQLLEYKSMVDATEEKSPEQILQDKQVEAKIEDLENEIEEVKIAFEMKK-LA
QP.K.AA..P.DSG.GGGEG.P.QV.......P.D..TLLLRLRAQ.K..LL.YKS.VDA.EEK..EQI.QDKQ.EAKIEDLE.E.EE.KIAFEMKK.L.
Retrocopy
QPKK*AAAKPSDSGVGGGEGGPAQV-WCPGVHPKDHFTLLLRLRAQGK**LLDYKSVVDANEEKALEQIVQDKQIEAKIEDLEREPEELKIAFEMKK\LV


Parental protein
LDRMQLSTALKKNLEKNNPRTSVLMDNMKHILKLN
LDRMQL..ALKK...K..P..SVLMDNMKH.LKLN
Retrocopy
LDRMQL*AALKKTWRKLTP--SVLMDNMKHVLKLN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide