RetrogeneDB ID:
retro_mputfur_246
Organism:
Location:
GL896899.1:31790366-31790798 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
82.64 %
Coverage:
68.93 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
BTF3
Parental gene aliases:
No gene alias available
Parental gene description:
basic transcription factor 3 [Source:HGNC Symbol;Acc:1125]

Genomic region (view in browser)





>retro_mputfur_246
GGTGGGAAAGGAGCTGCTTGCCTGAAGATGAAGGTGGTTCACAGAACTGCTACAGCAGAT
GATAAAACACTTCAGTTCTCCTTAAAGAAGTCAGGTGTAAACAGGATCTCTGGTTTTGAA
GAAGTGAATATGTTCACAAACCAAGGAATAGTGATCTACTTCAACAACCCTGAAGTTCAG
GCATTGCTGGCAGCAAACACTTTCACCATTACAGGCCATGCTGAGACAAAGCAGCTGACC
GAAATGCTACCCAGTATCTTAAACCAACTTGGTGCAGACAGTCTGACTAGTTGAAGAGGA
CTGGTTGAAGCTCTGCCCACACAATCTGAGTATGGAAAAGCACCACTTGCTACCAGAGAG
GAGGAGGAGGAGGATGATGAAGTTCTAGGTCTTGTGGAGAATTTTGATGAAGCTTCCAAG
AATGAAGCAAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRR
GGKG.A..K.KVVHRTATADDK.LQFSLKK.GVN.ISG.EEVNMFTNQG.VI.FNNP.VQA.LAANTFTITGHAETKQLTEMLPSILNQLGADSLTS.R.
Retrocopy
GGKGAACLKMKVVHRTATADDKTLQFSLKKSGVNRISGFEEVNMFTNQGIVIYFNNPEVQALLAANTFTITGHAETKQLTEMLPSILNQLGADSLTS*RG


Parental protein
LAEALPKQSVDGKAPLAT--GEDDDDEVPDLVENFDEASKNEAN
L.EALP.QS..GKAPLAT...E..DDEV..LVENFDEASKNEAN
Retrocopy
LVEALPTQSEYGKAPLATREEEEEDDEVLGLVENFDEASKNEAN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide