RetrogeneDB ID:
retro_mputfur_247
Organism:
Location:
GL896899.1:32831449-32831846 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
77.78 %
Coverage:
84.71 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
IFT20
Parental gene aliases:
No gene alias available
Parental gene description:
intraflagellar transport 20 homolog (Chlamydomonas) [Source:HGNC Symbol;Acc:30989]

Genomic region (view in browser)





>retro_mputfur_247
GCTGTGGTCAAGGAGATCCTGGGTGAAGAAGGCTGCACTTTGATGAGCTGGACAAGCTGC
ACGTGTGGGACCCTAAGGTCACCCAGCAGACCACAGAGTTCAAGGAAGAGTACAAGGACT
CTGTGGACAAAATTGGCCAGTTTCATAAAATAGTCGGTGGTTTACTTGAGCTTGTTGACC
AACTTGCAAAAGAAGCAAAAATGAGAAGATGAAGGCCACTGGTGCTCAGAACTTGTTCAA
ATCTATAGCAAAACCGAGAGAATCTCCACAGCAGCCACTGCAAGCACTGACAGCAGAACA
GAAAATGCAGCTTGGAAGGTATCGGGTTGAATAGGAAGCTTTGTGTAAAACAGAAGCAGA
ACAAAATTAATTTATTGACCAATTTATTTTTCAGAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AMAKDILGEAG-LHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAE-NEKMKAIGARNLLKSIAKQREAQQQQLQALI
A..K.ILGE.G.LHFDEL.KL.V.DP.VTQQT.E.KEE.KD.VDKIGQF.KIVGGL.ELVDQLAKEA..NEKMKA.GA.NL.KSIAK.RE..QQ.LQAL.
Retrocopy
AVVKEILGEEG/LHFDELDKLHVWDPKVTQQTTEFKEEYKDSVDKIGQFHKIVGGLLELVDQLAKEAK/NEKMKATGAQNLFKSIAKPRESPQQPLQALT


Parental protein
AEKKMQLERYRVEYEALCKVEAEQNEFIDQFIFQK
AE.KMQL.RYRVE.EALCK.EAEQN.FIDQFIFQK
Retrocopy
AEQKMQLGRYRVE*EALCKTEAEQN*FIDQFIFQK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide