RetrogeneDB ID:
retro_mputfur_251
Organism:
Location:
GL896899.1:38635142-38635577 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
80.0 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
Rpl26
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L26 [Source:MGI Symbol;Acc:MGI:106022]

Genomic region (view in browser)





>retro_mputfur_251
ATGAAGTTTAATCCCTTTGTGACTTCTGACCAGAGCAAAAACTGTAAACAGCATTTCAGT
GCACCATCCCACATTCGCAGGAAGATCATGTCTTTCCCTCTTTCCAAAGAGCTGAGATGG
AAGTAAAAGGTTCGATCCATGCCCATCCGAAAGGGTGATGGAGTGCAGGTTGTGCGAGGA
CACTACAAAGGTCAGCAAATTGGCAAATTATCCCAGGTTTGCAGGAAGAGACATGTCCTC
TACATTGAACCAGTACAGCAAGAGAAGGCGGATGGCCCAACTGTCTGTGTGGGCATTCAC
TCTAGCAAGGTGGTTATCACTAGACTAAAACTGGACAAAGACCGCCAAAAAGCCCTTGAA
CACAAAGCCAGATTTTGCCAAGTAGGAAAGGAAAAGGGCATATATAAGGAAGAAACAATT
GAGAAGATGCAGGAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIH
MKFNPFVTSD.SKN.K.HF.APSHIRRKIMS.PLSKELR.K..VRSMPIRK.D.VQVVRGHYKGQQIGK..QV.RK..V.YIE.VQ.EKA.G.TV.VGIH
Retrocopy
MKFNPFVTSDQSKNCKQHFSAPSHIRRKIMSFPLSKELRWK*KVRSMPIRKGDGVQVVRGHYKGQQIGKLSQVCRKRHVLYIEPVQQEKADGPTVCVGIH


Parental protein
PSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEETIEKMQE
.SKVVITRLKLDKDR.K.LE.KA...QVGKEKG.YKEETIEKMQE
Retrocopy
SSKVVITRLKLDKDRQKALEHKARFCQVGKEKGIYKEETIEKMQE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide