RetrogeneDB ID:
retro_mputfur_252
Organism:
Location:
GL896900.1:988265-988564 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
51.43 %
Coverage:
75.94 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
HMGN1
Parental gene aliases:
No gene alias available
Parental gene description:
high mobility group nucleosome binding domain 1 [Source:HGNC Symbol;Acc:4984]

Genomic region (view in browser)





>retro_mputfur_252
GCAAAGGCATGTGCCTGCCCTGCAGATACGATGCCTAAGGGAATGGCAAAGGAGGGCTCC
AAGAGGATATTAGCGACATTGCCAGCCAAATATACTTCTGCAAAAGTGTAAACGAAGCCA
AAAAAGGTGGCAGAAAAGGATCAATCTTCAGACAAGTGCAAACAAAGGGGGAAAGGGGAG
CAAAGGGAAAACCAGCTAAAGTGGCTACCAAGAAACAAAGAAGACTTGCAGAAAATGGAG
AAACTGAAAACAAGGAGAGCCCAGTCTCTGACAAAGCAGAAGAGAAGGAAGCCAAGTCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AVSSASPAPPSSPRGRARRTLSAALAF--QKPAPAKVEAKPKKAAAKDKSSDKK-VQTKGKRGAKGKQAEVANQEAKDDLPAENGETKN-ESPASDEAGE
A...A.PA....P.G.A.......LA....K...AKV..KPKK..A....S..K.VQTKG.RGAKGK.A.VA....K....AENGET.N.ESP.SD.A.E
Retrocopy
AKACACPAD-TMPKGMAKEGSKRILATLPAKYTSAKV*TKPKKV-AEKDQSSDK/VQTKGERGAKGKPAKVATK--KQRRLAENGETENKESPVSDKAEE


Parental protein
KEAKS
KEAKS
Retrocopy
KEAKS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide