RetrogeneDB ID:
retro_mputfur_254
Organism:
Location:
GL896900.1:10760151-10760495 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
68.07 %
Coverage:
99.15 %
Frameshifts:
3
Stop codons:
0


Parental gene:
Parental gene symbol:
RPLP2
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein, large, P2 [Source:HGNC Symbol;Acc:10377]

Genomic region (view in browser)





>retro_mputfur_254
ATGGAGATGTGCTACGTGGCCTCCTACCTACTGGCCACCCTCAGGGGCAATGCCTCCATC
CAATGTCAAGGGCATCAGGAAGAATCTGGACAGGTGAGCATCAAGGCAGATGATGACTGG
CTCGACAAGGTCATCAGAGAGCTGAATGGAAAAGTACTGAAGATGTCATTGCCCTGGGTA
TTGGCAAGTTGGCCAGTGTGCCCACTGGTGGGGCTGTGGCTGTGTCTGCTGTCCCAGGAT
CTGCATCTCCTGCTGCTGGTTCCACCCCAGTGGTGGCAGAGGAGAAGAAAGAGGAGAAAA
GGAAGGAGTTAGAGTCAGCTGACGATGTGGAATTTGACTTGTTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VRMRYVASYLLAALGGNAS-PSAKDIKKILD-SVGIEADDDRLNKVISELNGKNL-EDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGAAPAAAEEKK
..M.YVASYLLA.L.GNAS....K.I.K.LD..V.I.ADDD.L.KVI.ELNGK.L.EDVIA.GIGKLASVP.GGAVAVSA.PGSA.PAAG..P..AEEKK
Retrocopy
MEMCYVASYLLATLRGNAS\SNVKGIRKNLD/QVSIKADDDWLDKVIRELNGKVL/EDVIALGIGKLASVPTGGAVAVSAVPGSASPAAGSTPVVAEEKK


Parental protein
DEKKEESEESDDDMGFGLF
.EK..E..ES.DD..F.LF
Retrocopy
EEKRKEL-ESADDVEFDLF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide