RetrogeneDB ID:
retro_mputfur_255
Organism:
Location:
GL896900.1:12551688-12551952 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
69.32 %
Coverage:
56.05 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
RPL24
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L24 [Source:HGNC Symbol;Acc:10325]

Genomic region (view in browser)





>retro_mputfur_255
AAAAGAACCTTCTGTGCGGTCACATTCCAAAGGGCCATCACTGGTGCAACTTTTGTTGAT
AGAATGGTCAAGAGGAATCAGAAACCTGAAGTTAGGAAGGCTCAACGAGAACCAGCCATC
AGGGCTGCCACGGAAGCAAAAAGGACTAAGTAAACATCTAAAAGGACAGCAATGGCTGCC
ACCAAGACTCCCATGAAGGCAACAATGAAGCAAGAGGTTGTGAAGACTGTGAAGGTTTCT
GTACTCTGAGCTGGTGGAAAACGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KRTRRAVKFQRAITGASLADIMAKRNQKPEVRKAQREQAIRAAKEAKKAKQASKKTAMAAAKAPTKAAPKQKIVKPVKVSAPRVGGKR
KRT..AV.FQRAITGA...D.M.KRNQKPEVRKAQRE.AIRAA.EAK..K..SK.TAMAA.K.P.KA..KQ..VK.VKVS....GGKR
Retrocopy
KRTFCAVTFQRAITGATFVDRMVKRNQKPEVRKAQREPAIRAATEAKRTK*TSKRTAMAATKTPMKATMKQEVVKTVKVSVL*AGGKR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide