RetrogeneDB ID:
retro_mputfur_257
Organism:
Location:
GL896900.1:18308323-18308614 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.75 %
Coverage:
76.56 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
SUMO1
Parental gene aliases:
No gene alias available
Parental gene description:
small ubiquitin-like modifier 1 [Source:HGNC Symbol;Acc:12502]

Genomic region (view in browser)





>retro_mputfur_257
CAGGAGGCAAAACTGTCAGCTGAGGACTTGGGGTCATATAAGAAGGAAGGAGAATACAGT
AAACTCACAGTCCTTGGACAGGATAGCATTGAGATTCGCTTCAAAGTGAAAATGACAACA
CATCTCTAGAAACTCAAAGAATCATGCTGTCAGAGACAGGCAGTTCCAATGAATTCACTC
AGGTTTCTTTTTGAAGGTCAGAGAGTTGCTGATGACCACACTGCAAAAGAACTGGGAATG
GAAGAAGTGATTGAAGCTTATCAGGAATGAACGGGGTCATTCAACAATTTA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EEAKPSTEDLGD-KKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTI
.EAK.S.EDLG..KKEGEY.KL.V.GQDS.EI.FKVKMTTHL.KLKES.CQRQ.VPMNSLRFLFEGQR.AD.HT.KELGMEE..VIE.YQE.TG.....
Retrocopy
QEAKLSAEDLGSYKKEGEYSKLTVLGQDSIEIRFKVKMTTHL*KLKESCCQRQAVPMNSLRFLFEGQRVADDHTAKELGMEE--VIEAYQE*TGSFNNL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide