RetrogeneDB ID:
retro_mputfur_259
Organism:
Location:
GL896900.1:35852251-35853218 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
75.76 %
Coverage:
99.7 %
Frameshifts:
2
Stop codons:
4


Parental gene:
Parental gene symbol:
UCHL5
Parental gene aliases:
No gene alias available
Parental gene description:
ubiquitin carboxyl-terminal hydrolase L5 [Source:HGNC Symbol;Acc:19678]

Genomic region (view in browser)





>retro_mputfur_259
ATGACAGGCAGTACTAGGGAGTGGTGCCTCATAAAAAGGGACCCTAGGATCTTGACGGAA
CTCACTAAAGAATTTGGTTGCCAAAGAGCCCAAGTGGAAGAATTAAGGAGTTTAGAGCCT
GAGAATTTTGAAGAGTTAAAGCCAGTTGATGGGTTAATTTTTCTTTTCAAGTGGCAGCCA
GGAGAAGAACCAGCAGGCTCTGTAGTTCAGGACTCTGGACCTGACAGGATATATTTGCCA
AGCAGGTAATTAAAGATGCTTGTGCTACTCAAGCCATAGTAAGTGTGTTATTGAACTGTA
CCCATCAAGGTGTCTGTTTAGGAGAGACTTTATCAGAGTTTCAAGAATTTTCACAAAGTT
TGATGCAGCTATTGAAAGGTTTGGCACTCAACAGTTCAGATGTGATTTGACACGTACACA
ACAGTTTTGCCAGACAGCAGATGTCTGAATTTGGTGCAAAGACATCAGCAAAAGAAGATG
CTTTTCACTTTGTCAGTTATGTTCCTGTAAATGGAAGATTGCATTAATTAGGTGGATGAA
GAGAAGGACTGATTGGTTTCTGTACGCGCCTCCAGATGACTGGGTCAGTGCAGTGAGGCT
AGTCATAGAAAAAAGGGTACAAAAGTACGGCAAAGGTGAAATTTGATTTAACTTAATGGG
CATTGTATCTGATAGAAAAATGATATATGAAGAGAAGATAGCGGAGTTACAAAGACAATT
TGCTGAGGAACCAGTGGATACAGATCAGGGTAATAATATAACTGCTGTTCAGTCAGAGGT
TCCCAGAAACCAGATGCTTATTAAAGAAGAAATACAGAAACTAAAAAGATTTGAAAATAT
CAAAAGGAAGTATAATTATCTGCCTTTCATTTTGGAATCATTAAAGACTCTAGCAGAACA
CCAGCAGTTAATACCACTAGTAGATAAGGCAAAAGAGGACCAGAATGCAAAGAAAGCACA
GGAAACC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIF-FAKQVINNACATQAIVSVLLN
MTG...EWCL...DP...TEL.K.FGC..AQVEE..SLEPENFE.LKPV.GLIFLFKWQPGEEPAGSVVQDS..D.I..FAKQVI..ACATQAIVSVLLN
Retrocopy
MTGSTREWCLIKRDPRILTELTKEFGCQRAQVEELRSLEPENFEELKPVDGLIFLFKWQPGEEPAGSVVQDSGPDRIY/FAKQVIKDACATQAIVSVLLN


Parental protein
CTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDAKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQ-DDWIS
CTHQ.V.LGETLSEF.EFSQS.....KGLAL..SDVI..VHNSFARQQM.EF.AKTSAK.EDAFHFVSYVPVNGRL..L.G.REG.I......Q.DDW.S
Retrocopy
CTHQGVCLGETLSEFQEFSQSLMQLLKGLALNSSDVI*HVHNSFARQQMSEFGAKTSAK-EDAFHFVSYVPVNGRLH*LGG*REGLIGFCTRLQ/DDWVS


Parental protein
AVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGSNMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIME
AVR.VIEKR.QKY..GEI.FNLM.IVSDRKMIYE.KIAELQRQ.A.EEP.DTDQG.N...A.QSEV..NQMLI.EE.QKLKR...ENI.RK.NYLPFI.E
Retrocopy
AVRLVIEKRVQKYGKGEI*FNLMGIVSDRKMIYEEKIAELQRQFA-EEPVDTDQGNN-ITAVQSEVPRNQMLIKEEIQKLKRF--ENIKRKYNYLPFILE


Parental protein
LLKTLAEHQQLIPLVEKAKEKQNAKKAQET
.LKTLAEHQQLIPLV.KAKE.QNAKKAQET
Retrocopy
SLKTLAEHQQLIPLVDKAKEDQNAKKAQET


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide