RetrogeneDB ID:
retro_mputfur_261
Organism:
Location:
GL896900.1:38222113-38222749 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
61.75 %
Coverage:
69.03 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
NANOG
Parental gene aliases:
No gene alias available
Parental gene description:
Nanog homeobox [Source:HGNC Symbol;Acc:20857]

Genomic region (view in browser)





>retro_mputfur_261
AGTATGGATCCAGCTCAGCCCCAATGTCTGCCTTGCCCTGAAGCACCCAATTCTAGGGAC
TCTTCTCCAATGCCTGAGATTTACAGGCCTGAAGAAAATCATGCGTCCTTGCAAATGTCA
TCTGTTGAGACACCCCACATGGAGACCATCTCTCCTCTTCCTCCCTCCGTGGATCTGTTT
GTTCAGGACAGCCCGATTCTTCCACCAGTCCCAGAGTAAAACTACTACCCACTTCTATAG
AGGCGAGAACAGCGAAGAAGGAAGATATGGCCTTGGCCAAGAAACGGAAGATCAGAACCC
TGTTCTCTCAGATCCAACTACATATACTCAATGATGAACTTCAGAGACAGAAATACCTCC
GTCTCCCAGCAGATCCAAGGACTTCCCAATTCCGAACATTAGCTACAAGCACGTTAAGAC
ATGGTCCCAAAAACAGAGAATGAAATGTAAAAGGTGCCAGAAACACAATTGGCCAAATAG
CAACGGTATGACTTAGGACAGATCAGCAAATACAGAACACCCAGGCTTCTCTTCCTGTCA
CCAGGGATAACTGATGAACACTTCCAGAACCTTTCCATAGGGAGCAACCATCCCTGCAAC
AGTCAGACCTGGTGTCCCCAGGCCTGGAACAACCAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SADPAPPQCRSGPRPPGSRDSSPMPEVCRHEENYAFLQMSSAETPHAETVSPLPSSVDLLVQDSP-DSSTSPKVKLPPTSAEERTGRREDTAQGKKQKIR
S.DPA.PQC...P..P.SRDSSPMPE..R.EEN.A.LQMSS.ETPH.ET.SPLP.SVDL.VQDSP.DSSTSP.VKL.PTS.E.RT...ED.A..KK.KIR
Retrocopy
SMDPAQPQCLPCPEAPNSRDSSPMPEIYRPEENHASLQMSSVETPHMETISPLPPSVDLFVQDSP/DSSTSPRVKLLPTSIEARTAKKEDMALAKKRKIR


Parental protein
TVFSQTQLYVLNDRFQRQKYLSLQQMQELSN-ILNLSYKQVKTWFQNQRMKCKRWQKNHWPKESKSVTQNSTAATEYPAFYSYHQGHLMNTS-ANLPIWS
T.FSQ.QL..LND..QRQKYL.L......S..I.N.SYK.VKTW.Q.QRMKCKR.QK..WP..S...T....A.TE.P.F.S.HQG.LMNTS..NL.I.S
Retrocopy
TLFSQIQLHILNDELQRQKYLRLPADPRTSQ/IPNISYKHVKTWSQKQRMKCKRCQKHNWP-NSNGMT*DRSANTEHPGFSSCHQG*LMNTS/QNLSIGS


Parental protein
SQTWNNPNWSNQTWNSQ
....N...W..Q.WN.Q
Retrocopy
NHPCNSQTWCPQAWNNQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide