RetrogeneDB ID:
retro_mputfur_263
Organism:
Location:
GL896900.1:3477686-3478038 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
78.33 %
Coverage:
78.67 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
UBE2D2
Parental gene aliases:
No gene alias available
Parental gene description:
ubiquitin-conjugating enzyme E2D 2 [Source:HGNC Symbol;Acc:12475]

Genomic region (view in browser)





>retro_mputfur_263
TTGGGCCATGATCCTCCAGCACAATGTTTGGCAAGTTCAGTTGGAGATGATGTGTTTCAT
TGACAAGCCACAATTACAGGACCTAATGACAGCCCATATCAAGGTGGTGTATTCTTTTGG
ACAATTCATCTTCCTACAGATACCTCTTCACACTACCTAAGGTTGCATTTGCAACAAGAA
TTTATCATCCAAATATTAACAGTAATGGCAGCATTTGTCTCGATATTCTAAGATCACAGT
GGTCTCCTGCTTTAACTATTTCTCAAGCTCTTGTATCCATTTGTTCACTGCTGTGTGATC
CAAACCCAGATAACCCCCAGTGCCAGAGACTGCTTGGATGTATAGAACAGAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTD-YPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLC
L..DPPAQC.A..VGDD.FH.QATI.GPNDSPYQGGVFF.TIH.PTD.Y.F..PKVAF.TRIYHPNINSNGSICLDILRSQWSPALTIS..L.SICSLLC
Retrocopy
LGHDPPAQCLASSVGDDVFH*QATITGPNDSPYQGGVFFWTIHLPTD/YLFTLPKVAFATRIYHPNINSNGSICLDILRSQWSPALTISQALVSICSLLC


Parental protein
DPNPDDPL-VPEIARIYKTD
DPNPD.P..VPE.A..Y.T.
Retrocopy
DPNPDNPQ/VPETAWMYRTE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide