RetrogeneDB ID:
retro_mputfur_27
Organism:
Location:
GL896918.1:3826126-3827680 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
73.32 %
Coverage:
93.88 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
Aldh2
Parental gene aliases:
No gene alias available
Parental gene description:
aldehyde dehydrogenase 2, mitochondrial [Source:MGI Symbol;Acc:MGI:99600]

Genomic region (view in browser)





>retro_mputfur_27
ATGCTGCGCCCCCTGGTGCCCCGGCTGCTTTGCCTCCGTGTCCGAACCGCCCCATACTCT
TCCGCGGCCGCCCTTCCAAGTCCCATCCCAAACCCAGACATCCGCTACAACCAGCTGTTC
ATCAACAATGAGTGGCAAGATGCCGCCAGCAAGAAGACCTTCCCGACAGTCAACCCCGCC
ACGGGAGAGGTCATTGGCCACGTGGCCGAAGGGGATCGGGCTGACGTGGATCGGGCAGTG
AAAGCAGCCCGCGAGGCTTTCCGCCTGGGGTCTCCATGGCGCCGGATGGATGCCTCCGAG
CGCGGCCGGCTGCTGAACCGCCTGGCGGACCTAGTGGAGCGGGATCGTGTCTACCTGGCT
TCACTGGAGACGTTGGACAATGGGAAGCCTTTCCAGGAGTCCTATGCCTTGGACCTGGAT
GAGGTCATCAAAGTATACCGGTACTTTGCTGGCTGGGCTGACAAGTGGCACGGCAAGACC
ATCCCCATGGATGGAGAGCATTTCTGCTTCACCCGCCACGAGCCTGTCGGCGTCTGTGGC
CAGATCATCCCATGGAACTTCCCCTTGGTCATGCAGGGCTGGAAACTCGCCCCGGCACTG
GCCACCGGCAACACAGTGGTCATGAAGGTGGCAGAGCAGACCCCCCTTTCTGCCCTGTAC
TTGGCCTCCCTCATCAAAGAGGCGGGCTTTCCCCCTGGGGTGGTGAACATTGTCACCGGC
TACGGCCCCACGGCAGGTGCCGCCATCGCCCAGCACATGGATGTCGACAAGGTGGCCTTC
ACCGGCTCTACTGAGGTGGGCCACCTGATCCAGAAGGCGGCTGGCGATTCCAACCTGAAG
AGAGTCACCCTGGAGCTGGGTGGGAAGAGCCCCAGCATCGTGTTGGCCGACGCGGACATG
GACCACGCCGTGGAGCAGTGCCACGAAGCCCTGTTCTTCAACATGGGCCAGTGCTGCTGT
GCGGGCTCCCGGACCTTCGTTGAAGAATCCATCTATGACGAATTTCTTGAGAGAACGGTG
GAGAAGGCTAAGCAGAGAAGAGTCGGGAATCCCTTTGAGCTGGACACCCAGCAGGGGCCC
CAGGTGGACAAAGAGCAGTTTGAACGAATCCTGAGCTACATCCGTCTTGGCCAGAAGGAG
GGGGCACAACTTCTCTGCGGCGGGGAACGTTTTGGGGAGCGCGGTTTCTTCATCAAGCCC
ACGGTCTTTGGCGGCGTGCAGGATGATATGAGGATCGCCAGAGAGGAGATCTTTGGGCCT
GTGCAGCCCTTATTTAAATTCAGGAAGATGGAGGAGGTGATCGAGAGGGCCAACAACACC
AGGTATGGCTTGGCTGCCGCCGTGTTCACCCGGGATCTGGACAAGGCCATGTACTTCACA
CAGGCGCTCCAGGCCGGCACGGTGTGGGTAAACACCTACAACATTGTTACCTGCCACACG
CCCTTTGGAGGGTTTAAGGAATCTGGCAATGGGAGGGAGCTGGGGGAGGATGGGCTTAAG
GCCTACACGGAGGTGAAGACAGTTACCATCAAGATTCCTCAAAAGAACTCGTAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AATEVVPAPNQQPEVFYNQIFINNEWHDAVSKKTFPTVNPSTGEVICQVAEGDKEDVDRAVKAARAAFQLGSPWRRMNASDRGRLLNRLADLIERDRTYL
......P.P...P...YNQ.FINNEW.DA.SKKTFPTVNP.TGEVI..VAEGD..DVDRAVKAAR.AF.LGSPWRRM.AS.RGRLLNRLADL.ERDR.YL
Retrocopy
SSAAALPSPIPNPDIRYNQLFINNEWQDAASKKTFPTVNPATGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVYL


Parental protein
AALETLDNGKPYVISYLVDLDMVLKCIRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTAL
A.LETLDNGKP...SY..DLD.V.K..RY.AGWADK.HGKTIP.DG..F..TRHEPVGVCGQIIPWNFPL.MQ.WKL.PALATGN.VVMKVAEQTPL.AL
Retrocopy
ASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSAL


Parental protein
YVANLIKEAGFPPGVVNIIPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMSDADMNWAVEQAHFALFFNQGQCC
Y.A.LIKEAGFPPGVVNI..G.GPTAGAAIA.H.DVDKVAFTGSTEVGHLIQ.AAG.SNLKRVTLELGGKSP.I...DADM..AVEQ.H.ALFFN.GQCC
Retrocopy
YLASLIKEAGFPPGVVNIVTGYGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADMDHAVEQCHEALFFNMGQCC


Parental protein
CAGSRTFVQEDVYAEFVERSVARAKSRVVGNPFDSQTEQGPQVDETQFKKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDSMTIAREEIFG
CAGSRTFV.E..Y.EF.ER.V..AK.R.VGNPF...T.QGPQVD..QF...L.YI..G..EGA.LLCGG.....RG.FI.PTVFG.VQD.M.IAREEIFG
Retrocopy
CAGSRTFVEESIYDEFLERTVEKAKQRRVGNPFELDTQQGPQVDKEQFERILSYIRLGQKEGAQLLCGGERFGERGFFIKPTVFGGVQDDMRIAREEIFG


Parental protein
PVMQILKFKTIEEVIGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVSM
PV....KF...EEVI.RANN..YGLAAAVFT.DLDKA.Y..QALQAGTVWVN.Y.......PFGG.K.SG.GRELGE.GL.AYTEVKTV..
Retrocopy
PVQPLFKFRKMEEVIERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide