RetrogeneDB ID:
retro_mputfur_271
Organism:
Location:
GL896900.1:31670011-31670585 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
63.55 %
Coverage:
67.01 %
Frameshifts:
6
Stop codons:
4


Parental gene:
Parental gene symbol:
ZNF346
Parental gene aliases:
No gene alias available
Parental gene description:
zinc finger protein 346 [Source:HGNC Symbol;Acc:16403]

Genomic region (view in browser)





>retro_mputfur_271
GCCAACAAAGCGAATGTCTTCTTAGCAATCATGGAATGGAGGTGTTAAAGGGGGAAACAA
AGAAGCTATATGCAGATCAGAAGACCTGCAGAAGCAAAGACAAGAACCAGTGCTGCCCCA
TTTGTAGCATGACCTTTTCATCCACTGTTGTGGCCCAGGGGGAAGATCCATGCAAAGAAC
TTAAAGCTGAAGCAGCAGTCCATTAGTGTAGAAGGCTTGCACCAGAATAGAGCTGATAGA
CCAAGACAAGTTCTGCAGCTTCTGCCAGGTGACTTTCAAAGACCCTGTCATGGCTCCACA
ACCTTATGTGGGCAAGAAACACAGGAAATAGGAAATCAAGCTCAAACTCATGGCACACTA
TGAGCGGCTGGTCGGCCAACTGTCCTGACTCATCAGCTGGGAAGGGCTACCCCTGCAAGA
TATATAAAATAGTCCTGAACTCTATAGAATAGTATCAAGTTCATGTCAGTGACTTCAAAC
ACAAGAGCCAGTCACCAAGCCAATGGCATCACATCTGGGCTAGATTCCAATGCAAAAGCA
GCCATTTTAGAAAGACTTCACCCCCTTGGAAAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ANKVKRYLAI-HGMETLKGETKKLDSDQKSSRSKDKNQCCPICNMTFSSPVVAQSHYLGKTHAKNLK-LKQQSTKVEALHQNREMIDPDKFCSLCHATFN
ANK....LAI.HGME.LKGETKKL..DQK..RSKDKNQCCPIC.MTFSS.VVAQ....G....K.LK.LKQQS..VE.LHQNR....P.....L....F.
Retrocopy
ANKANVFLAI/HGMEVLKGETKKLYADQKTCRSKDKNQCCPICSMTFSSTVVAQ----GEDPCKELK\LKQQSISVEGLHQNR-ADRPRQVLQLLPGDFQ


Parental protein
DP-VMAQQHYVGKKHRKQETKLKLMAHYGRLAD-PAVTDSSAG-KGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSP-KTMASPLGQIPVQRQPVLKDSAT
.P.VMA.Q.YVGKKHRK.E.KLKLMAHY.RL...P.V.....G.KGYPCK..KIVLNSIE.YQ.HVS.FKHK.QSP.K.MAS.LG.IP.Q.QP..KD...
Retrocopy
RP\VMAPQPYVGKKHRK*EIKLKLMAHYERLVG/PTVLTHQLG/KGYPCKIYKIVLNSIE*YQVHVSDFKHKSQSP/KPMASHLG*IPMQKQPF*KDFTP


Parental protein
LED
LE.
Retrocopy
LEN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide