RetrogeneDB ID:
retro_mputfur_276
Organism:
Location:
GL896901.1:7051812-7052212 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
51.82 %
Coverage:
54.69 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
RNF138
Parental gene aliases:
No gene alias available
Parental gene description:
ring finger protein 138, E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:17765]

Genomic region (view in browser)





>retro_mputfur_276
CTGTGCCCTCAGGTGTTGGAAACACTACAAACAGTGACCTGGCAGCACTTCTCTTGTAAC
AAAAATGTGTCCTACCGAGATGAGAGAGAGTGAAATAAATTGTCATTTCTGCCATAAAAA
TATGACCAGAAGAGAGAAGTCATGTCTTGAGTGAACTTCACACATTGAAAATGTCACGAG
GGAGTTTTCTACTAGCTGTGGAAGCTGTAAAAACAGATTAAATTCTAGCGCCAGAGATAT
CATTACAAATCTTATAAAAAAGATCAAGACGGATACAGCGCTGCCTCTATAATTCCAACC
TCTCAGATCTCTCAAGGTTCAGCAGGGAACATTAAATAAGAGTGAAGCATCCACAGCTGA
CAGCATGGAAAACTCTGAAGGGAATACTCCATCTTCTGGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VCQEVLKTPVRTAACQHVFCR-KCFLTAMRESGIHCPLCRGNVTRRERACPERALDLENIMRKFSGSCRCCA-KQIKFYRMRHHYKSCKKYQDEYGVSSI
.C..VL.T...T...QH..C..K...T.MRES.I.C..C..N.TRRE..C.E.....EN..R.FS.SC..C..KQIKF.R.R.HYKS.KK.QD.Y...SI
Retrocopy
LCPQVLET-LQTVTWQHFSCN\KMCPTEMRESEINCHFCHKNMTRREKSCLE*TSHIENVTREFSTSCGSCK/KQIKF*RQRYHYKSYKKDQDGYSAASI


Parental protein
IPNFQISQDSVGN-SNRSETSTSDNTETYQENTSSSG
IP..QISQ.S.GN..N.SE.ST.D..E....NT.SSG
Retrocopy
IPTSQISQGSAGN\LNKSEASTADSMENSEGNTPSSG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide