RetrogeneDB ID:
retro_mputfur_277
Organism:
Location:
GL896901.1:9262273-9263209 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
76.97 %
Coverage:
57.69 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
TRAFD1
Parental gene aliases:
No gene alias available
Parental gene description:
TRAF-type zinc finger domain containing 1 [Source:HGNC Symbol;Acc:24808]

Genomic region (view in browser)





>retro_mputfur_277
ATGTGTCCTATATGCAAGGAACCATTTCCCAAATCTGACATGGAGAGTCACATGGCTACA
GAACCTTGTCAGGTGACCTGAAAATGTCAAATAAGTTGGAGGAGAGGCAGATAAAGAAGG
GTGAGGAGACTGAGGGTCCTCTATGGCTTACCCTTTGCCAGCACTGTGATTTCGAACTTT
TTGTTCTCAAACTGAAGGACGATGGAGATTACTGTGGTGCCCGGCTGAAGTTTTGGGGCA
GTTGTGGGTGCAATGTCTTGGTGAAAGATCTGAAGACTCATCCTGATGCTTGTGAAAGAG
ACAGGGAGGAAAAGAGAGATGAGGTTGCCATGCCTCCTAAAGCAACTGATGAGTCCGGGG
GTCAAGATGGCATCTACTTTGCATCCCAGCTTCTCAGGCAAATTGAGGCTCTGGACCCAC
CTATGAGGCTTCTCCAAAGACCTCTGGGAGCCTTTGAATCAGACACTTTCCATAGTAGAA
CTACCAACCAAAGGAACACGACAGCCCAGATTCCAGCTCAGAATAATCTACTGGAAGAAC
GAGAAAGGGAGGGAAGGAATAGAACCTGACAGCCCCCAAAAGAAGACAATGCAAACTTGG
ACTTCAGGTTGGCCCTAAGTCTGGAAAATGAAGGACAGGCCTGCAATGTGGAAAAGCAGG
ACTTCTGGAGGGCTGCCTGTGGTACAGACAAGTCCCTTGAAGCGTCCAAAGCTCTGAATG
ACATGAAAGGTGCAGCTGACCAGGCCATGTTGCCTTGTGAATTTTGGGAGGAGCTCTACA
CAGAGGAACTGCTGGTTGACTATCAGACAATCTGTAGTCTTTCCTGTGCCTTACCTACAC
TCAGTATGGGCAGTACTTCCCCCATAAGGGGTGGAGGACCCTGATGTCATCTTCCAAAAG
TCTTTGCAGCAGGCTGTGAGTAACCAGTTCGACTCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MCPICKEPFPKSDMESHMATEHCQVTCKC-NKKLEKRQLKKHEETECPLRLALCQHCDLELSVLKLKDHEDYCGARTELCGSCGRNVLVKDLKTHPDVCG
MCPICKEPFPKSDMESHMATE.CQVT.KC...KLE.RQ.KK.EETE.PL.L.LCQHCD.EL.VLKLKD..DYCGAR....GSCG.NVLVKDLKTHPD.C.
Retrocopy
MCPICKEPFPKSDMESHMATEPCQVT*KC/SNKLEERQIKKGEETEGPLWLTLCQHCDFELFVLKLKDDGDYCGARLKFWGSCGCNVLVKDLKTHPDACE


Parental protein
RDGEEKRDEVAMPPNAYDESWGQDGIWIASQLLRQIEALDPPMRIPRRPLRAFESDILHSRTSNQRNMAAQFPIQNNLLEEQERQERNRTRQPPKEGGED
RD.EEKRDEVAMPP.A.DES.GQDGI..ASQLLRQIEALDPPMR...RPL.AFESD..HSRT.NQRN..AQ.P.QNNLLEE.ER..RNRT.QPPKE...D
Retrocopy
RDREEKRDEVAMPPKATDESGGQDGIYFASQLLRQIEALDPPMRLLQRPLGAFESDTFHSRTTNQRNTTAQIPAQNNLLEEREREGRNRT*QPPKE---D


Parental protein
SANLDFMLALSLQNEGQARSVAEQDFWRAVCGTDQSLEGSSALNDMKGAADQTMLPCEFCEELYPEELLIDHQTSCNPSCALPARSVGSTSPK-GVEDPD
.ANLDF.LALSL.NEGQA..V..QDFWRA.CGTD.SLE.S.ALNDMKGAADQ.MLPCEF.EELY.EELL.D.QT.C..SCALP..S.GSTSP..GVEDPD
Retrocopy
NANLDFRLALSLENEGQACNVEKQDFWRAACGTDKSLEASKALNDMKGAADQAMLPCEFWEELYTEELLVDYQTICSLSCALPTLSMGSTSPI\GVEDPD


Parental protein
VIFQKFLQQATSNQLDS
VIFQK.LQQA.SNQ.DS
Retrocopy
VIFQKSLQQAVSNQFDS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide